Identifiers and Description

Gene Model Identifier

Contig17537.0.g93

Standard Name

FUBP1a

Aliases

Contig17537_0_g93

Description

KH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000517207.998336109808381e-38KH domain containing protein
SGDYLR116W0.00000000000009996062864481225MSL5 SGDID:S000004106, Chr XII
from 380822-382252, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17537.0.g93(coding)
ATGCCTAAGCATTCAAGATCTAGGTCTACAGAGAGAAAACGCGATCACAAGCATAAAGAT
AAGAAAAAGCACAAGAAACACTCTAGAAGCAGAAGTGGTAAGAGAGACCACAAAGACTCA
AGAAGAAGAGACGATGACAGAGGAGAAAAGTCAGATCGCAGACATAGAGATGATTATAAA
AGTTTAGAGAGAGAAAGAGATAGAAATGCTCATGGCTCAGGTTCATAGTCAGGAAGCAGT
AGATAAAGAGAGCCAACTAGCAATTTCAGCTAAATTCCACCAACTGGTTCAATCTCTAAT
TTTTAGAGTTTGCCTTAGCAGCCACTTCAAGGAGGATCAAATTTTAGCAATCAGCCATTA
AGATCAAATGGGCAGGAAGGAGGTTTTACTTAGTACCAAGGTGGACATGATGAAAACTTT
AACAAATGGGGAAACAACAAACCTGATGAACAATAATAATTGACAGCTTAATAAATTAAT
GAAGAGCAAGCTAGAAAAGAAAAGAGAATGAGCAGATTTACTGAAACACCTGTCGGACTG
CAACCAAATCAGCAAGGTTTGAACGATAGAAATTTAATGCCACCTCCAGGAATTCCCTAA
AAAAGAAAGAAATTTGTGTGGACTGATGCAAATGAAGAAGAATTAAGATAGCAATAACTT
GTTGAAAAAAGATACGGCCTTGACTCTTCACAGCCAGCTTTGATGTTCGGAGGAGCAAAT
CCCTCACTAATGCAAAACTTAAGTCCTGCTATCTTGAGTGCACTTCAGGATTCCTCAAAG
ATTAAAAAGAAGATATACTTACCCAAGAATTCAGGTGTAAACTTTATCGGTTTACTTATA
GGTCCCAAAGGTCTCTATCAAAAGAGACTAGAAGAGGAGTCTGGTTGCAAGATTTTAATA
AGAGGTAGAGGTTCTTAAAAAGAGGGCTCAGCTCCTTAACCAGATGACGACGATGATTAA
CATGTTCTTGTGATTGGAGATTCAGTTGAGAATGTCAGAAGAGCATAAAATGCAATTGAA
AGAGTTGTTTCAGCAGATGATTCAACAAGAAATAAGATAAGAGAAGAGCAACTAAGTGTT
GCACAGTAGATTAATAACTAAGTCTTACCTACCTCACAAATGGATGATAGCATGATGACG
CCATACGGTCCACCTTCCCCTTATGCTTACATTATTCCTGTTCCTAATGACTGTGTAGGA
CTTATTATAGGTAAAAGTGGTGATACTATTAGATAGCTTCAGCAAGATAGTGGAGCTAAG
ATTTAAGTAGCAAAGAAGGAAATCCCTAATAGTAACCTAAGAAATGTCTTTGTAGAAGGC
ACACCAGACAAATATCAGAAAGCCAAAGAGCTTATTGAGGAGATTATTAAAGATCAAAGA
AGGTCAAGTGATCCTTAAATTCATGTTGGAGATGTAAATCCATTCCATGGACCACATCAC
AAGATTAAAGTTCCAGATAAATTTGTAGGTTTAATCATAGGAAAGAGTGGAGAAAATCTC
AGAGGTATTGCTTAAAGAAGTAACACCAAGATATTCGTACCATAGAAGAATAATGACCCT
GGAGCAGAAGAGAGAATCATTGAAGCAGATGGTGATCTTCAAAACATTGAAATAGCTAGG
CAGGAAATCCTTAATTTGATTCAGCGATACATGACATAAAATAATGCAAACAGCTTTGAT
TATTCTAAGAATCCTTATGGGAGTGGAATTGCAGTTTATAACCAACAGAAGCTAGCATCT
GATGGTCAGCAAATAAATGGAGCAGTGCCTGATTCATTGAAGCCAGAAAGTGGAAGTTAT
GCAAGCAGTTTGCTGACTGATAATCCCATGATTGCCTATGCAAGCATGCAGTTAACTGGT
TGGTCTTACGAAGATCAAAACTAGCAAGATGGTCGTGGATAAGGAGGAGCACCAGATCAC
TCGACAACTGCAACCAGTCATGCCGCTTATGGTTAAGAACCAGGCTACGACTACAGCCAA
TACTATGGCTAATATCCAGCTCCAGGTTAAGAAGGCTATGATGCAAACTACTACAATCAA
TATTATCAATAGTAGCCACCTCCTTATTATGATTAATAAGCTTACAATCAAAATCCAGAG
CAGGCTGTCGCTAAATAAGCAGAGCCCAGCTCTGGTGCTTAACCAGACTAAGCACATCAA
GATTACTATACATAGTAGTACTATCAGCAGTACTATGCAGGATAATATGGAGCTCCAGCT
GGCTAACCACCTGCTGACTACAATGCTTATTATCAGTAGCAGTATTATGAAGGAGGAGCT
GCTGCTTATGGTTAGCCCTAATCCTAACCAAATGCTGAGTAGCAACAAGCATTGCCTTCT
TCTACTGACGATGCAGGTAGAACTGATGGCAAGCCTAATTAATGA


>Contig17537.0.g93(protein)
MPKHSRSRSTERKRDHKHKDKKKHKKHSRSRSGKRDHKDSRRRDDDRGEKSDRRHRDDYK
SLERERDRNAHGSGSQSGSSRQREPTSNFSQIPPTGSISNFQSLPQQPLQGGSNFSNQPL
RSNGQEGGFTQYQGGHDENFNKWGNNKPDEQQQLTAQQINEEQARKEKRMSRFTETPVGL
QPNQQGLNDRNLMPPPGIPQKRKKFVWTDANEEELRQQQLVEKRYGLDSSQPALMFGGAN
PSLMQNLSPAILSALQDSSKIKKKIYLPKNSGVNFIGLLIGPKGLYQKRLEEESGCKILI
RGRGSQKEGSAPQPDDDDDQHVLVIGDSVENVRRAQNAIERVVSADDSTRNKIREEQLSV
AQQINNQVLPTSQMDDSMMTPYGPPSPYAYIIPVPNDCVGLIIGKSGDTIRQLQQDSGAK
IQVAKKEIPNSNLRNVFVEGTPDKYQKAKELIEEIIKDQRRSSDPQIHVGDVNPFHGPHH
KIKVPDKFVGLIIGKSGENLRGIAQRSNTKIFVPQKNNDPGAEERIIEADGDLQNIEIAR
QEILNLIQRYMTQNNANSFDYSKNPYGSGIAVYNQQKLASDGQQINGAVPDSLKPESGSY
ASSLLTDNPMIAYASMQLTGWSYEDQNQQDGRGQGGAPDHSTTATSHAAYGQEPGYDYSQ
YYGQYPAPGQEGYDANYYNQYYQQQPPPYYDQQAYNQNPEQAVAKQAEPSSGAQPDQAHQ
DYYTQQYYQQYYAGQYGAPAGQPPADYNAYYQQQYYEGGAAAYGQPQSQPNAEQQQALPS
STDDAGRTDGKPNQ