Identifiers and Description

Gene Model Identifier

Contig9216.0.g23

Standard Name

FTSJ2

Aliases

Contig9216_0_g23

Description

FtsJ-like methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004567108.996537154595168e-51FtsJ-like methyltransferase fa
mily protein
SGDYBR061C6.001696815660978e-24TRM7 SGDID:S000000265, Chr II
from 365719-364787, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9216.0.g23(coding)
ATGATGCAACATATTCAAAAGCGAATGTACGGTGTAGTTGCGAACCAAAATATGAAACCA
GCTGCGAAAAAATGGATGGAACGCCATCTTAATGATCCCTTTGTAAAGCAAGCCAAGCTC
CAAGCATATAGAAGCAGAGCAGCCTATAAATTGATGGAAATTGATAATAAATTTTCTATA
TTTAAGAAAGGTATGAAAGTTATTGATGTTGGATGTGCACCAGGAGGATGGTCATAAATT
ATTGCAGAGAAAGTTGATTCTCAGCCAGGTTCAGAAACTGCTGTAGGAGTAGACTTAATT
GAAATAATACCAGTGAAAGGAGTTAAGTTTATCTAAGGAGATATTCAAAAGTAGGATATT
CAGGATAAAATATCAGAAGCCCTAGACTTTCAAAAAGCAGATTTAATATTGTCAGATGCA
GTACCAGATTTTGTGGGCGAACGCTATATCGATCACATGAAATCAGTGAATTTAAATCAC
TTAATTTTGAAATTCTGTGAGAAAAACCTAAGACCTGGTGGATTATTACTCATGAAAATA
ATGCAAGGACCTGCAGAACAAGACTTATTCGACTACACTAAGCTGTTGTTTGATAATTTG
CAACGAGTAAAGCCCTCAGCGTCCCGCTAGGAATCGAAGGAGATATATTTGCTAGGGAAG
GGCTGGGAAGAAAGCCAAAATGAAAATATGATCAAGATTAGAAAAGAGTTAGCTAGATTT
AACAACGCAAAGTCTGAATAAGAATAATCTATGTTGATGGAGGAATTAATGAAAGAGGCC
AAAGTAGAAATGAAGAAAGGTATCGAGGAAATACTTAAAACTGGCTAAGAAATTCCCGAT
GAATTTAAGTCAGAACTCAAGAGTGTGCCAGAAGCTGCCGATATCAATCTAGAACAAAAG
ATGAGCTTAAGAGAGAAACAGAAAGCTCTCAAGAAATTTAAGCAAGACTAAGATCGTGAA
TTTGAGGAGAAAACTGGAATTGTAAATAAATCAGAGAATTGGACTATGGACAATTTAATC
AAGAAATATTAGTATGATATGGCTTAGTACGACAAAAAACTAGAAAAAATGAAGAAATTA
GATGAATAAGGAGTTCAATACAACCCTGATGAAGTAGTGGTCTCTGATGAGGAGAATAGT
GCAGTTTAGGATCCATTTAAACTATCAAATAAAAAAGTTGAATACGACGACACCCCTTAT
CAGCAGGATGACCCACTTCAGCACATTAATGATGAATATGAGAAGTTGAAGATCAATTTA
GACAAATTACAAAACCTTGGAGATAAATTTGATGATATCGATCCTAACCACCCTAATTTT
GAAAAATATCAGGAATTCTTTAAAGACATGGATAAAGTTCATAGCATGGCAGCAGACTAC
GAAGACTAAACCTTTGAAGACTCAATGGATAAGGACGAACAGAGGACTTACGCTGATACT
CAAAAGACTCAAAGAAAAAGTAAAGACGCTTATTTTGATAAGTAGTAGAAGAGATAACAT
TTAAAGAAAACCGGAGGTGTCAAGAAAGACTCACCTGTGTGGAATGATTCTGATGAGGAA
GATTGA


>Contig9216.0.g23(protein)
MMQHIQKRMYGVVANQNMKPAAKKWMERHLNDPFVKQAKLQAYRSRAAYKLMEIDNKFSI
FKKGMKVIDVGCAPGGWSQIIAEKVDSQPGSETAVGVDLIEIIPVKGVKFIQGDIQKQDI
QDKISEALDFQKADLILSDAVPDFVGERYIDHMKSVNLNHLILKFCEKNLRPGGLLLMKI
MQGPAEQDLFDYTKLLFDNLQRVKPSASRQESKEIYLLGKGWEESQNENMIKIRKELARF
NNAKSEQEQSMLMEELMKEAKVEMKKGIEEILKTGQEIPDEFKSELKSVPEAADINLEQK
MSLREKQKALKKFKQDQDREFEEKTGIVNKSENWTMDNLIKKYQYDMAQYDKKLEKMKKL
DEQGVQYNPDEVVVSDEENSAVQDPFKLSNKKVEYDDTPYQQDDPLQHINDEYEKLKINL
DKLQNLGDKFDDIDPNHPNFEKYQEFFKDMDKVHSMAADYEDQTFEDSMDKDEQRTYADT
QKTQRKSKDAYFDKQQKRQHLKKTGGVKKDSPVWNDSDEED