Identifiers and Description

Gene Model Identifier

Contig3070.0.g97

Standard Name

FOK2

Aliases

Contig3070_0_g97

Description

Restriction endonuclease FokI, catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02980 ) Restriction endonuclease FokI, catalytic domain
  • ( pfam10696 ) Protein of unknown function (DUF2501)
  • ( pfam14195 ) Domain of unknown function (DUF4316)
  • ( pfam05030 ) SSXT protein (N-terminal region)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3070.0.g97(coding)
ATGTAATTGGTTTCAAGAGTCTCATCATTAAGGTCATCTGTAAATCGCATAACTTCGAAT
AAATATGCCCAAGCAGATCCAACTCCAAATGAGATCGTAATTTATAATACTTTATTAAAG
AACAAAAATAAATTGAATTTTGATAATTCACAAGAGTCAACTAACTTTGGTTACACTAGA
ATAATTAATGGTATGTTAAGGAAATCCGAGTTGACTAGTTCTAATTTAAATGAATTACCA
ATGTTATAAGCTCATTAATCAAATCCAATAACCTAAAATTACTAATTCTAAAATAAAAAA
GTTAAAGTCTTAATTGAATAAAATAGTAATAATATATTGCCCATAGTAACAAACTAAGAG
TCAAATAAAAAATATTAAGACCCCTCTTACTTTAACAAAATGGATAACCTTAAAAAAAGA
CAAAAACATAGAAGAATTACTGAGTTACTTAAAATCAATAAGTTATACTAAATGAATGAT
TAATAAAAAGTATCAATCAAAGCTTAAAGTGATGGTTAAGTTATATCGTAGTAAATTATA
TAAAAAATTTTGGAAGAAGAGAGACAGTTGCAGGATATAGTCTTTCTGTCATCTTGA


>Contig3070.0.g97(protein)
MQLVSRVSSLRSSVNRITSNKYAQADPTPNEIVIYNTLLKNKNKLNFDNSQESTNFGYTR
IINGMLRKSELTSSNLNELPMLQAHQSNPITQNYQFQNKKVKVLIEQNSNNILPIVTNQE
SNKKYQDPSYFNKMDNLKKRQKHRRITELLKINKLYQMNDQQKVSIKAQSDGQVISQQII
QKILEEERQLQDIVFLSS