Identifiers and Description

Gene Model Identifier

Contig1303.1.g87

Standard Name

FOK1

Aliases

Contig1303_1_g87

Description

Restriction endonuclease FokI, recognition domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02981 ) Restriction endonuclease FokI, recognition domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1303.1.g87(coding)
ATGCTGACAACTAAACTCATCGCTCTCTCCGTGATCGCTTTCACCTCTCTGACTCAAGCC
ACTCCCTTGTTCAGAAACACCCTCCTCTCCACCCCAGCTGCTCAATTGGCTGACACTTTC
AACCCAGAGACTGCTTCATGGCCAAAGGTCAACATCCCACATGAATTCTAAGCCACTGCC
AGAGTCTTCGTTTGGGATCAGGACAGCAAGCAATTGCAAGACTAAAAGCAATTTGGAGTT
ATTAAGATGAGCGCCTCACTTAATCATTAATGGTTCAGTGAAGGCATCATTAACGCTGAT
GGCTCAAATTCAACCACTTAGATCGATGTACTCAATCACAACAGTCAGAGAGATATCTTC
TACAAAGCTCTTCCAAAGAAGAGTTGTGGAAGTGAAGAGTTCTCAGACGACAGCACTGTC
GAGAGCATTATTGACAAAACTTTCGACCCAACCGTCCAAAAGAATTTGCAATACGGCGGT
GTTGAATCACCAGAATGGGACTTAACCACAAAATACAACAGACTTAACTCTATCACCCCA
AGTGGATCTATTGGTGAGTCATACTACTACACTGTTGATACTGGATCCTTGAGATACGAA
GTCTCTTATGACGATAAAATCGCTGTCAAGAATTTCGGTGCAGGTTTCATTCCAAAGACT
TTGACCATCCGCAATGACTTCATCATTCAAGAATGCGTCCAAAGACTCTTCCTTGAATGA


>Contig1303.1.g87(protein)
MLTTKLIALSVIAFTSLTQATPLFRNTLLSTPAAQLADTFNPETASWPKVNIPHEFQATA
RVFVWDQDSKQLQDQKQFGVIKMSASLNHQWFSEGIINADGSNSTTQIDVLNHNSQRDIF
YKALPKKSCGSEEFSDDSTVESIIDKTFDPTVQKNLQYGGVESPEWDLTTKYNRLNSITP
SGSIGESYYYTVDTGSLRYEVSYDDKIAVKNFGAGFIPKTLTIRNDFIIQECVQRLFLE