Identifiers and Description

Gene Model Identifier

Contig20974.0.g95

Standard Name

FIP1

Aliases

Contig20974_0_g95

Description

Fip1 motif

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR093C0.00000009004106436083642FIP1 SGDID:S000003853, Chr X f
rom 604203-603220, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20974.0.g95(coding)
ATGGCATAATAGCAAACAAACCCAGAGTACGAAGATGGGTAGGCATTTGCCTAGCAAGAT
CAACCTTCAGTAAGCTAAGTAGTCGCTCCTTAAAGGATAGATCTTACCAATCTATTCTTT
GATGATGACGATGACTATGAATTTAATGGGGGATTTGGAGGTCCTATCAACCAGTCAAGC
AATCATCAATTTGGTGGATAATAGTAAATTAATGGGGGAATGTCTAACAATAATGCATCA
CCATCAAAGTATCAAAATCTGAATGGAGATATGCAGGATGAGTACAACTATGATGAAATT
TTAGAGGATGCAGAGGGGAATTATCAAACTCAAAAGAATGACGACCAAGGCTAAATGACA
GATGAGCAACAAATTTAAATCAATACTGCTACAAATGGGACTCAAGCAGTGCCAGGTGGT
GCAGTTCCTAGAAGAGCATTAAGATAAATTAAGAATTTTCAGGTACCAGAAATCATACAA
TTTGATATTGACACATTGGCTGAAAAGCCTTGGAGAGAGCAGAAAGATAAAATGTCTGAT
TACTTTAATTTCGGTTTCAATGAAGACTCGTGGAAGAAATATAGGTAGTATATTATGTAA
AATTGCGAGACAGATCTTTAACGTTTGAATGATGATCAAGATTTGAGCAAGATATTTTCT
GATAATAAATACCGTCATGCAGTAATTGACTTTTACTTGCCTCATGAATACGGTGGATTA
GGAGATTGCATGAATCCTTAATACTCCCAATTAAACACTTTCCCTGAAACTATGGATCTC
CCTCTTATTAAGCCAAAAACTACTCTATAGAACAAAAATGAGTTCAATGTAAATATTGAG
AAGACAGCATAACTAGCTGGAGATCATGCAGATATGAGTTTGTTTACAAAACACATTCTT
ATGGAACCAGAAAATGCTGATAGATTGAAAGAATTGCAAGACTAAGTTAAGTTGAAACGT
CAAGAGCTAGATGCTGAGAAAAAAGCACTGAAAGCAATTGAAGAGGATTTAAAGAAAAAC
AGAGAAAAAACAGAAAGAGAAGCTAAAAATCAAAGGTCTACCAGCAAAAGAAGCTCAAGC
AGTAAACGTGATGATAATGCTACACCATCTAAATCCTTTACATCATCATCTAGAGACACT
ACAGTTGCTTCAAGCAGTCATCATCATACTTCAACAGCACGAAGCTATCATCAATATCAA
AAGGAAAAAAGTGAAAAACCTCCAACTTCTAGTGCCACAACTGATAGAAGTGAAAGAGGT
GCTGCTAATGGCAAATCCAAAAGTCGCAGCAGAGATAGAGATTATAAGTCTCGTAGAGAT
AGAGAAAGAGCCACTGATGTCAAAAGAACCGATAGAGATAAGGACAAGAGTAGCAGATCA
AATAGCGCTTCTAGAAGGCATCATAATGATGTTGAAAAGGAGAGAGATAAGCTTAAGAAA
TATGGAGGCGATAGAGATAAAGAAAGAGGGAAAGACCGTGAAAGAGAAAGGGAAAAGGAA
AGATTAAGAGAAAAGGAAAGAGAAAAGGAAAAAGAACGTGAAAGAGAGAGGGAAAGAGAG
AAATCCAGATAAGATGCCGATAAAAGCAATAATGCAATTAAAGATAAGAAATAAACTGAT
AAAGTTAAAACATCAGCTAGTGATAGAGTTAGAGGAGATGAACCAAGCAAAAAGAAGAGT
CCTTCTCCTTAAAGATCAAAGAATAAGAAATCTAGAAGTAGATCTTATGAATCTAGAACT
AGAAAGAGAAGTAACTCCAACAAAAGAAGAGATGATAAGTTCTCTAGGAAGGAAGCTGAT
TCAAAATCCAAAAGATCTGAAAGAGAAGAACAAGACTAAAAGTCTTCTCGCAAAATACTA
AAGGAAGAACCTAGAGACAGACTGAAATAGCCCTCTATTTCAACTTCAGGAAGCGCTTCT
CAATCAACTTTGAACAATCCTGAAAGCTAAAAGGATAAAATTTAGCCATCAAAAACAAAG
AATCTTACAGCAGAGTTGAAAAGAGATAATCTCAAAAATGTTTTAAAGACTGAACCTAAG
AAAGAAGATTCTCAAATTTCTAGGATTCTGGCAATCAACACTCCTGGAAAAACCATTGCA
AATGGAAAGAAAATTTCAATTGTGAGAGGAGCTGGAGAGAGTTAAATTATCATTAAAGAT
ACTAATGTAAAGGAAAGCAGTTTAACTAGCATTCCTATAAATAATTCAAATTCTTCAAAT
CATAATTCAAATTAAAACTCATAAATACCAAACACCCTTACCACTGCCACTAATTAATCT
TCAAATGGTCTTCGCAATGGTGCAAAGGCTATTTTGAATAATGCATTCAAAGCTATTGAT
CAGTAAAATTAAAAAGAGTAGTAATTGAACAACATCAAGCAGAGACATGATTCATTAGAT
TTGACTGCAGGGCTTTTGGGACTTGGAGGAGATGACTTGGACTTCGAAGATACTGGAAAT
GTAGTTTCAGCAGGTGGGGAACAAATTAAAAAAATTATCCCAGCACATGCTGCTTCCGAA
GAACTTCTCGTCATTGTTAGAAAAAAGAAATGA


>Contig20974.0.g95(protein)
MAQQQTNPEYEDGQAFAQQDQPSVSQVVAPQRIDLTNLFFDDDDDYEFNGGFGGPINQSS
NHQFGGQQQINGGMSNNNASPSKYQNLNGDMQDEYNYDEILEDAEGNYQTQKNDDQGQMT
DEQQIQINTATNGTQAVPGGAVPRRALRQIKNFQVPEIIQFDIDTLAEKPWREQKDKMSD
YFNFGFNEDSWKKYRQYIMQNCETDLQRLNDDQDLSKIFSDNKYRHAVIDFYLPHEYGGL
GDCMNPQYSQLNTFPETMDLPLIKPKTTLQNKNEFNVNIEKTAQLAGDHADMSLFTKHIL
MEPENADRLKELQDQVKLKRQELDAEKKALKAIEEDLKKNREKTEREAKNQRSTSKRSSS
SKRDDNATPSKSFTSSSRDTTVASSSHHHTSTARSYHQYQKEKSEKPPTSSATTDRSERG
AANGKSKSRSRDRDYKSRRDRERATDVKRTDRDKDKSSRSNSASRRHHNDVEKERDKLKK
YGGDRDKERGKDREREREKERLREKEREKEKEREREREREKSRQDADKSNNAIKDKKQTD
KVKTSASDRVRGDEPSKKKSPSPQRSKNKKSRSRSYESRTRKRSNSNKRRDDKFSRKEAD
SKSKRSEREEQDQKSSRKILKEEPRDRLKQPSISTSGSASQSTLNNPESQKDKIQPSKTK
NLTAELKRDNLKNVLKTEPKKEDSQISRILAINTPGKTIANGKKISIVRGAGESQIIIKD
TNVKESSLTSIPINNSNSSNHNSNQNSQIPNTLTTATNQSSNGLRNGAKAILNNAFKAID
QQNQKEQQLNNIKQRHDSLDLTAGLLGLGGDDLDFEDTGNVVSAGGEQIKKIIPAHAASE
ELLVIVRKKK