Identifiers and Description

Gene Model Identifier

Contig20371.0.g31

Standard Name

FEN1c

Aliases

Contig20371_0_g31

Description

XPG I-region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00867 ) XPG I-region
  • ( pfam00752 ) XPG N-terminal domain
  • ( pfam01367 ) 5'-3' exonuclease, C-terminal SAM fold
  • ( pfam02739 ) 5'-3' exonuclease, N-terminal resolvase-like domain
  • ( pfam12091 ) Protein of unknown function (DUF3567)
  • ( pfam05184 ) Saposin-like type B, region 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004376179.99583921019208e-96flap endonuclease-1
SGDYKL113C1.0000521619018958e-77RAD27 SGDID:S000001596, Chr XI
from 225875-224727, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20371.0.g31(coding)
ATGGAGAGTCTTTCAGGAAGAACTCTTGCTTGTGATGCTTCAATTGTAAGATTTATTTTA
ATTGTAATTGTTTCAATTAACTAGGCTATCTATTAATTCTTGATAAGTACAACATACAAT
GTAAAGGGTGTTGGGGTAAAGCAATTTACAGATTAATAAGGAAATTAGACAGCTCATTTG
ATAGGGTTATTCAACAGAAACATTTAATTCGCTCAGCATGGGATAAAAGCAATATGGGTA
TTTGATGGCAAGCCACCAGAGCTTAAAAGTAGAACTCTTGAGAAACGTAAAGAAAACAGA
GATAAGGCAGAGGATGAAAAGGAAGAAGCTCAGGAAGACGGAGATGAGTTTAAAATGGCG
AAAATGGCTTAGAGGACAGTCAAGGTCACTAAATCTATGGTTGAAGATGCAAAAAGATTA
GTTAAAGCTATGGGCTTCCCTGTGGTTCATGCTCCTGGAGAAGCAGAAGCGTTTTGTGCA
TATCTAGTGAAGGAAGGAAAAGCATTCGCTACAGTGAGTGAAGATATGGATTCATTAACA
TTTGGAAGTCCATTTATGATAAGAGGAATGAGTATGGCCAAATAAAAAGCAGGGATTGAA
TTGATGCAGATAGAACTTTCTAAAGTTCTATTCTCACTAAAACTTACTTATGAAGAATTT
GTTGATTTATGCATAATATGCGGGTGTGATTATACTGCAACTATTACTGGAATTGGTGCA
GTCAAAGCCTATAAATTTATCACTGAATATAGAACAATTGAGAAAGTTTTGAAGGCAATC
GACAAAGAAATTTTCTCTTCAAAAGGAAAGAAAGCGAAATATATCATCCCAGAAGATTTC
CCTTATTAAGAAGCACGTGAACTATTTTTACATTAGGATTATAAAGAATAACTATAAGAA
TTGCAGGATCAGTTAAAATGGAATAAACCAAATGATGAAGAAATTAAGGAATTCTTAATA
AAAGAAAAGAACTTTAATGAAGAGAAAGTTGATAATGGTTTGAAGAAGCTAAACAAATTT
TCACCAACTCAGGGAAGAACTCAAGTAAGATTAGACTCATTTTTCAAAAGTAATACTACG
ACCTCTACATCGACAACACCAAATAAAGATACTAAAAAATCATAGACTCCTATATAAAAA
TCTAAACCATCCAATGGGTTTAAGAGGGGTAAGAGATGA


>Contig20371.0.g31(protein)
MESLSGRTLACDASIVRFILIVIVSINQAIYQFLISTTYNVKGVGVKQFTDQQGNQTAHL
IGLFNRNIQFAQHGIKAIWVFDGKPPELKSRTLEKRKENRDKAEDEKEEAQEDGDEFKMA
KMAQRTVKVTKSMVEDAKRLVKAMGFPVVHAPGEAEAFCAYLVKEGKAFATVSEDMDSLT
FGSPFMIRGMSMAKQKAGIELMQIELSKVLFSLKLTYEEFVDLCIICGCDYTATITGIGA
VKAYKFITEYRTIEKVLKAIDKEIFSSKGKKAKYIIPEDFPYQEARELFLHQDYKEQLQE
LQDQLKWNKPNDEEIKEFLIKEKNFNEEKVDNGLKKLNKFSPTQGRTQVRLDSFFKSNTT
TSTSTTPNKDTKKSQTPIQKSKPSNGFKRGKR