Identifiers and Description

Gene Model Identifier

Contig21980.0.g55

Standard Name

FEN1b

Aliases

Contig21980_0_g55

Description

XPG I-region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004376178.999018432448718e-113flap endonuclease-1
SGDYKL113C9.999776257620412e-83RAD27 SGDID:S000001596, Chr XI
from 225875-224727, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21980.0.g55(coding)
ATGGGAATTCATAAGTTAATGACTCTTATTTAAGAGAAAGCTCCGAAAGCAGTTAAGACA
ATCCAATTAGAATATTTAACAGGAAAAGTTATAGCCTGCGATGCCTCTATGGCAATTTAT
CAGTTCTTAATTGCCACTTAAACTATGAAGCAAGGTATGGGAATTGGGGAATTAAGAGAT
TCAAACGGAAATTTAACAGGTCATCTAGTTGGAATGTTTCACAGAACTATACAATTTTTA
GAAAGTGGCATTAAGCCAATCTGGGTATTTGATGGAAAACCACCAGATCTCAAAAACAGG
GTGCTAGATCAAAGAAAAGAGACAAAGGAAAAAGCAGTCGAAGAAAAGAAAAATAGAATA
GAAGAGGGAGACATGGAAGGGGCAAAGAGGATGGCTGGTAGATCAGTGAAAGTTACATGG
GATATGATGAGAGATGCCAAAAAGCTGCTTCGATTGATGGGTTGTCCGGTAATAGATGCT
CCAGGAGAAGCTGAAGCTTAGTGCGCTCATTTGGTAAAACTTGGATTAGCTTTTGCAACG
GCTTCCGAAGACATGGACTCACTAACTTTTGGTACTAAAGTTTTACTTAGGGGCTTTAAT
AGTAAGAAAGAACCAATCATTTAGATTGATCTTGAGGAGGTGCTTGAAGGTTTTATGATG
AATCATGATTAATTCATCGACTTGTGCATACTCTGTGGTTGTGATTACACAACAAGCATA
ACAGGAATAGGTCCTATCAAAGCTTATTAATATCTCTCTGAGCATGGTGGAATTATTGAA
AACGTTATAAAGAAAGTAGAGTATGAAAACTAAAAGCCTTGGAAAAAGAAGAAATATCAC
ATCCCGGAAAATTTCCTATTTAAAGAAGCAAGAGAGTTGTTTAAGAACCCGCGAATTGAA
AAGGATTAGTCTAAATTGGAATACAAAATAAAATGGACAAAACCAGATGAAGAAGGACTT
AAGGAGTTCTTAATAACTTAGAAGGGCTTCAGTGATGTTAAAGTGGATTCAGGCTTAAAA
AAGTTAAAAGGATGCTAGGGTAAAACCAATTAGGGAAGACTTGATTGCTTTTTTGGTAAC
ACTTTTAAGAAAACTTCAAATAATTAGGTCATTGAAAAAGGCAAGGGTAAAAGCAAATTT
GGAATATAAAAGGAACCCGAAGATGAAATCAAGAGTTGGTATGATGACCCATTTAGTGTA
CCTGGTAAAATTAATGGTCGCAAAGATTCAAATTTACACTTGACTCAAGCCTCATTCTCT
ACTTAAGATTTCAAAGAATCCCTCTCATCTAACTATGCATCTGCTAATACCACTACCATC
ACAAATGTGTTAAAGGAAAATAGAGACAAGACTAAAATGGACAGTATTGGTAGCCCTGTA
CGATAATAGTCGACAGAAGATCTGAAGCAACTTTAAGCTAAAATCAATCAAATGGAGGAC
TAAATCAGTAAAATAGAGTACTCTTAAGATACCATGAGGCCTGTGCTGAGATAAATTTAG
ACACCCTAAGGCTAATAGTAGCTGCTGTAAAATCTATTGAAGCAACAACAATAGCTATTG
AATCCCTTAGAACAAGAGAGACAGAGCAAGCAAACTGAAGAGCAGCATGAGCTTATTAGA
AGTTACTCAACTAAAATTTAAGAGTAAAGTACAAAGCAGGATGAGCTTTTTAAGAGAAAC
ATCGATGGTTTGAAGATTAAGAAAATGGAACTTGACTTCAATTTGGAATAATAATAGAAA
TATCTAATTGCTAGATTGAAAGAAAGTGAGGGCAAAGTACTTGAAGATAAGCAGCAGTTG
TTTTAAGATCTATCAAGAAAGCAAATCGATTAGAGAGAAGAAATTATTCAAAAAATACAG
AGCATTAAAAACAAGAGCTTATAAGAAAATGACTAGCAAAACTAGCAGCTTTAAGCTATT
TATGAAAGATTAGACAACATGCAAAAGAATTATGGACATAAAGTTAAAAACATAGAGTCT
TCTGAGATCATTTATAAAAGGATTAAGAACTAAACTAAAAGTGTTGTTAACTTAAGTCCA
AACTTGAAGAACCAGGAAAATATTTAAGCAAATAGCAATTAAACCAACAATCGATAAATC
TCATATCAGAAAGAATCTAGTTAAAATTTGGATTCTACATAGATTCTTAATAATACTCAG
ACATTGACAAGAAGAAATCAAAGTATAGTAATGAATGCTAGCCAAATAAAAGAAGATATT
AAGAAATCCTTGGAGAGTTTAGAGGCTTATTCCCTAAAAACCTCAGAGGACATCAATGAA
GAAATCGAAAATCTAAATGGCTGTGTAGACTCAAACTCTTCTGCCCTCCAGAAATCTCTC
ATAGACTTGCAAGAACTACAAGACCAGGATAAAAACGCAAAAGAGATCGAAGACTATGCT
AACAGAATAATTTCCTAGTTCCAGTAGTTCTCTGAATACATTAGGAACGAGTTGATTAAG
ATCAGGAAATTAGTTTTGCATAGATAGTAGTCCGCAGATGGGGAGTTTGGAAAGCAAAAC
ATTATGATTGAGTAATTGCAGAGAATAGTTGTTTCCGAGAGCACAAGCTCAGGCTAGAGT
GTTGTACAAAAGATTGATCAAATTAAAGAGCATTAGGAGGCATTGAAGAAGCACATGCAA
AACACTCAAGGATATCTCACAAGAGAAGCAAACCAAATTGATATGAAACTTATGCAACTT
CAAGACTTGATTGTTAAGGAAATTGAGCCATATATCTCAATTATAGAGGAGTAGAATTAG
AGACTTAGTGATGGTTCCAGCAATTAAAAGAGTGGAAAAATCAGTAATATAGTGAAACAA
AATATTAGTGCTATTCCAGAGGATGGGGCTGAATATTTACATACAGAAGACCAATTAGAT
GATTCTATAGGAAATTAAAATTGA


>Contig21980.0.g55(protein)
MGIHKLMTLIQEKAPKAVKTIQLEYLTGKVIACDASMAIYQFLIATQTMKQGMGIGELRD
SNGNLTGHLVGMFHRTIQFLESGIKPIWVFDGKPPDLKNRVLDQRKETKEKAVEEKKNRI
EEGDMEGAKRMAGRSVKVTWDMMRDAKKLLRLMGCPVIDAPGEAEAQCAHLVKLGLAFAT
ASEDMDSLTFGTKVLLRGFNSKKEPIIQIDLEEVLEGFMMNHDQFIDLCILCGCDYTTSI
TGIGPIKAYQYLSEHGGIIENVIKKVEYENQKPWKKKKYHIPENFLFKEARELFKNPRIE
KDQSKLEYKIKWTKPDEEGLKEFLITQKGFSDVKVDSGLKKLKGCQGKTNQGRLDCFFGN
TFKKTSNNQVIEKGKGKSKFGIQKEPEDEIKSWYDDPFSVPGKINGRKDSNLHLTQASFS
TQDFKESLSSNYASANTTTITNVLKENRDKTKMDSIGSPVRQQSTEDLKQLQAKINQMED
QISKIEYSQDTMRPVLRQIQTPQGQQQLLQNLLKQQQQLLNPLEQERQSKQTEEQHELIR
SYSTKIQEQSTKQDELFKRNIDGLKIKKMELDFNLEQQQKYLIARLKESEGKVLEDKQQL
FQDLSRKQIDQREEIIQKIQSIKNKSLQENDQQNQQLQAIYERLDNMQKNYGHKVKNIES
SEIIYKRIKNQTKSVVNLSPNLKNQENIQANSNQTNNRQISYQKESSQNLDSTQILNNTQ
TLTRRNQSIVMNASQIKEDIKKSLESLEAYSLKTSEDINEEIENLNGCVDSNSSALQKSL
IDLQELQDQDKNAKEIEDYANRIISQFQQFSEYIRNELIKIRKLVLHRQQSADGEFGKQN
IMIEQLQRIVVSESTSSGQSVVQKIDQIKEHQEALKKHMQNTQGYLTREANQIDMKLMQL
QDLIVKEIEPYISIIEEQNQRLSDGSSNQKSGKISNIVKQNISAIPEDGAEYLHTEDQLD
DSIGNQN