Identifiers and Description

Gene Model Identifier

Contig12777.0.g42

Standard Name

FEN1a

Aliases

Contig12777_0_g42

Description

XPG I-region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004376179.996261361959507e-120flap endonuclease-1
SGDYKL113C8.997107083354175e-87RAD27 SGDID:S000001596, Chr XI
from 225875-224727, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12777.0.g42(coding)
ATGGGAATTCACAAACTTATGACTCTTATCTAAGAGAAAGCCCCTAAAGCTGTTAAAACT
ATCAATTTGGATTTGTTAACAGGCAAGACTGTAGCTTGTGATGCATCTATGGCTATCTAC
TAGTTCTTGATTGCAACTTAATCTATGAAACAAGGTATGGGAATTTCAGAAATGCGCGAT
TCCGAAGGAAATTTGACTGGCCATCTGGTCGGACTTTTCCATCGTACTATTCAGTTCATG
GAGAATGGTGTGAAGCCAATCTGGGTCTTCGACGGCAAGCCACCCGAACTCAAGAGCTAC
GTCCTCGATCAGAGAAAAGAAAACAAAGAAAAAGCTGAAGAGACTAAACAGACTATGATT
GACGCGGGAGATTTGGAAGGCGCCAAACGTATGGCTGGCAGATCAATTAGAGTTACTCCA
GAGATGATGGAAGATGCCAAGAAGCTTCTCAGATTAATGGGTACTCCAGTTGTTGAAGCA
CCAGGTGAAGCTGAGGCTTAATGTGCAGTCATAGTTAAGCATGGACTTGCTTATGCTACT
GCTAGTGAGGATATGGACTCTCTAACTTTTGGAACCAATGTGCTATTAAGAGGTTTCAAC
AGCAAAAAAGAGCCCATCATTCAAATCGATCTCGCTTAAGTTTTAGAAGGCTTCAACTTA
AATCACGAGTAATTCATTGATCTTTGTATTCTTTGTGGTTGCGATTATACTACAAACATT
CCAGGAGTTGGCCCAGTCAAGGCATTTAAGTTTATTTCAGAAGAAGGTGGTACAATCGAG
AATGTCATTTCAAGAATTGAGAAAGAGAACGATGATCCAAAGAAGAAGAAGAAGTATACT
ATTCCAGAGACTTTCTACTATAAGGAAGCCCGTGAGCTTTTTAAAGTGCCATCAGCTATT
TCAGATATTGCAGAACTTGAGAAAATAATTAAGTTCAACAAGCCTGATGAGGTAGCTCTC
AAGGAGTTCCTTGTTACAAGCAAAGGGTTTTAAGAAATCAAGGTTGAAAATGGAATTAAA
AAGCTCAAGGCTACTGCTGGAAAGACTAACTAAGCAAGACTAGACTGTTTCTTCAAAGGC
GCAGGCACTAAGACTTCATCTACCTAAAGCAAGGATAAGAAATCAATTGGTGGAAATGGT
TCAGGTATGATAAAAAGCAGTGCAGGCACATAAGCTAACACTGCCAAGAAAAGCTGGCCC
GGTAAAGTTAAGTGA


>Contig12777.0.g42(protein)
MGIHKLMTLIQEKAPKAVKTINLDLLTGKTVACDASMAIYQFLIATQSMKQGMGISEMRD
SEGNLTGHLVGLFHRTIQFMENGVKPIWVFDGKPPELKSYVLDQRKENKEKAEETKQTMI
DAGDLEGAKRMAGRSIRVTPEMMEDAKKLLRLMGTPVVEAPGEAEAQCAVIVKHGLAYAT
ASEDMDSLTFGTNVLLRGFNSKKEPIIQIDLAQVLEGFNLNHEQFIDLCILCGCDYTTNI
PGVGPVKAFKFISEEGGTIENVISRIEKENDDPKKKKKYTIPETFYYKEARELFKVPSAI
SDIAELEKIIKFNKPDEVALKEFLVTSKGFQEIKVENGIKKLKATAGKTNQARLDCFFKG
AGTKTSSTQSKDKKSIGGNGSGMIKSSAGTQANTAKKSWPGKVK