Identifiers and Description

Gene Model Identifier

Contig3615.0.g45

Standard Name

FCP1b

Aliases

Contig3615_0_g45

Description

NLI interacting factor-like phosphatase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam03031 ) NLI interacting factor-like phosphatase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002773900.0000000039998859049333245NLI interacting factor-like ph
osphatase famil...
SGDYMR277W0.00000039992052383199455FCP1 SGDID:S000004890, Chr XII
I from 820256-822454, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3615.0.g45(coding)
ATGAACCAGCTACTATAAGATAGGAAACTAGTGTTAGTGTTAGATTTAGACAATACACTT
TTGCACACTAAAAGCATAGAGGAAAGGGAATTTCAAACTAAATCAAGAGACCCAACTTTC
ATCAACCTAATCGACCCTCTAAAGAGTATATACGAAATTAAATTATTCCGAGGTGGTTTC
CACACAAAACTCAGACCTTTTCTTTTTGAATTCCTGAAGAAAGTGTTTGATGAACGCAAA
TTTGAGATTTACTTCTACACAGCTGGCACTAAAGACTATGGCATGCTCATCATTGATATT
TTCAAGATGGAAATCACAAGACTTTTCGGTAAAGAATACGCAAAACAAATCAGTGAGGAG
CTATCTCACAGGAAATTGATTAGCAGGTGTGACAAGGAAAGATTTGCCAACAAAAATTCA
AGTAATGAAATTGATATTGATAGTATGCAACAGTAGCTGTATTAATAGATTGAGAATCAG
CAAATGGGATAAGGTGGTGATGCCACACTTAACATGAAACACTTTATTAAAAGTCTAAGC
AGCTTAGCTGGTGGAGATGAGAGTATTTTCATTATCATAGATGATCGCTCTGATGTATGG
ACAGAAGAAGTTAAAGATTAAAATGGTAATAAACTCAGGAGGGTGTCTGACAACCTAATT
CTAATTCCAGAGTATTTTTATTGGGAAACCTCACAAAACAGATTGAAATCTTACCATAAA
ATAATACAATAATCAGGCGTAAAATATGACTTTGACCTCTCTTTAGTCTATCACTATAAA
CTATTGACGAAGATTCATAATAAATTTTATGAGGAAGTTGATAGCTTAGGGTACTCAAGT
GTTAAACCTATTATTAGAGATTTGAGAACTAACATCTTTTAGAAAAATGAAGTTGCCATA
TTTGATATACTCTTTATGAATGACAAATAAAACATAGTGAAAAAGAGTGAGATTGACAGA
TCTTATGAAGGAATGCTGTCTTAGAGATTCGGTTTGGGTTATTAAGAGTCTATTGATCAG
GATTGTACTAAGCATTATATCTTTCTAGTTGATGATTACATTTCAAATCCTGTTAAAATG
AAGAAAGTGAGTTAAGCAAGAGCCTTGGATTTCGAAGGAATTAAAACCTCAGTAGCAAGC
ATTTATTGGCTTTATTTGTCATGTCACTTCTACAATGAACTTCCTCTTGAGGCATTCAAT
GGCTTGAAAGAGAGCAAGTACCCCGAAGAATAGAGAATAAATGAGCTATTGAGCAAATGC
TTGGAGATTGAGGAAACGGGGTTGTATGAAAGTTATAAAGAAAGATTCAATATGTTAGAA
GAGAGAAAGAAACATAGAGAATATGTTAAAAAATAGAATGAGGAACATAAACTGTAGCAA
GAGAATGGTAAGACTCAAAATGATCATTAGCAGGAATAGGAGGAAGATAATTTAGATACA
ACTTAGGATAACCAAACAATAGAAACTTAGAGATAACAATTAAAAAGATCACATGAAACA
GCTGATGATGATAATAAGGTTGTTAATGAAGACTAAGACCAAATCGAGAGTGATAGTAAA
AGGTAAAGAGTCGATTGA


>Contig3615.0.g45(protein)
MNQLLQDRKLVLVLDLDNTLLHTKSIEEREFQTKSRDPTFINLIDPLKSIYEIKLFRGGF
HTKLRPFLFEFLKKVFDERKFEIYFYTAGTKDYGMLIIDIFKMEITRLFGKEYAKQISEE
LSHRKLISRCDKERFANKNSSNEIDIDSMQQQLYQQIENQQMGQGGDATLNMKHFIKSLS
SLAGGDESIFIIIDDRSDVWTEEVKDQNGNKLRRVSDNLILIPEYFYWETSQNRLKSYHK
IIQQSGVKYDFDLSLVYHYKLLTKIHNKFYEEVDSLGYSSVKPIIRDLRTNIFQKNEVAI
FDILFMNDKQNIVKKSEIDRSYEGMLSQRFGLGYQESIDQDCTKHYIFLVDDYISNPVKM
KKVSQARALDFEGIKTSVASIYWLYLSCHFYNELPLEAFNGLKESKYPEEQRINELLSKC
LEIEETGLYESYKERFNMLEERKKHREYVKKQNEEHKLQQENGKTQNDHQQEQEEDNLDT
TQDNQTIETQRQQLKRSHETADDDNKVVNEDQDQIESDSKRQRVD