Identifiers and Description

Gene Model Identifier

Contig17229.0.g37

Standard Name

FCP1a

Aliases

Contig17229_0_g37

Description

NLI interacting factor-like phosphatase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam03031 ) NLI interacting factor-like phosphatase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR004C1.0002869940498747e-21NEM1 SGDID:S000001046, Chr VII
I from 113094-111754, Gen...
T. thermophilaTTHERM_004115103.9992896861436003e-19NLI interacting factor-like ph
osphatase famil...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17229.0.g37(coding)
ATGAACGATTAAAAACAGGAAAGAGAGAACAACGATCTAACAGAATAAAAGTTCCAAGAA
TAGTAATAAAATCATACCCACGCACCACAGAAATAATAAGAACAACTGTAACAAGAATCC
AATATCAATTAAACAACTAATATCACAAATCTCTATGTCATCAATGATGCCTAATTTGAG
TTCAAATTCTCATCATAAGGCCATAGTATAATAGATGTGAGTAAAACGAATCAGTAATTA
ACATCTAACGCCACCATTAATTAGTCCGCTAATCACCTAACAATCAAGCAAGCCAATCCA
GCAGCCACAAACTCACCTCAACAAACCTAAAACAAACAGCTTTAAATGAATCAATCATCA
AATTAAAAATAAAGTTAGGGTCAAGCTGCTAATGGCGGAAATATTGGAGTATTGGGATAG
AAGAAAATGCTGAGTTTAGGCTTGAAAAATAGAAAGTAAATGGTTAGTAAAACATCAAGT
TTAAATCCTACTTCCACTGTAATCAATGTTTAAGGTAGTAATGGGAATAACAGCACACCT
TAGAAGCATTCCAATGAAAGTTTACTCATATCTGCTTGTGTTACAAGTGACAAAAAGGCA
ACTTCAGTAAGTGATGGCACCTCATAAAGAAATAGTAACATAAAAATTTCAAGTTTAGTA
AGTGATCATAAATCTAGTACCCTACAAATCCAAAATAATACTCTAGTTAAACTGTCGAAC
TCTAATAAAAAAACTGTATAAACATAAATTAACAGCACTACGTCATCCTAAGGTTAATCT
ACTTAATAGAACAGTGAAGAAGATTAAAAGCGAGTAAAATACGAGAGAACAAATAAAGCC
CTGAAATAAACCAAAAAGGAAATCGAAAGTTCTTGTGATAAAATACTCTCATTTTTCATA
AACTCAGTGATAATTAAGTGTATCAGACTAGCTGTATACTTCTCTTATGCGATTATATTT
TTTTGCTCAATACCACTTTAAATCCTCTACTGCAGTGTTGAGATTATGTTTGGATCATGT
TTTAGGGGTAACAACTCAAGGGATATGGAACAGAGGAAAGCTTAAGGGAAATGTATTAAA
TGCCGTAGTAATCGCAAGACAGTATAAACACAATGGGAAAGACAGCAATAAAGAAAGCTT
CAGTTTATGATAGATGATGAAGATAAAGAGACTTTAACATAGCAGAGAAAGCAAACAATT
TGTAAACAAAATTAAGATTGCCTTGAAGATCAATAAACATAGTAGTCTTCTTGCAATACA
AACTGTAGCTCAAGTAATTTTGATAAAATGAGATTTACTCATACAAATAAGAGGCTTATC
GTTGTGTTGGATCTTGATAATACACTTATTCATAGTGTGAATAGCGTCCCGACATCATCT
GACCAGAACTATTTCGCAATTAGAGACAATATTTATGTTTATAAAAGACCTCATATGGAG
TATTTCTTAGCAGAAATTGCCAAATTTGCCGATATTTACATCTTTACTGCTAGTATGAAG
GATTATGCCGATTAAATCATGGATGTGATTGACCCTAAGAAAACCTTTGGGAAGTGCTTC
TATAGAACTGACTGTAAGAAAGATGAAAGGAGACAAATTTACAAAGATTTATCAACAGTA
TCTGATGACTTGACTTAACTGATTATGATAGACGACAATGAAATAAATTGCACAAAGAAT
CCTTTGAATACATTTAAGATAAAACATTGGACAAAATCTATGAGAGACGACACCTGCTTA
AAGTCTTGTCTTTCCTTAATTAAATATCTTCGATATTCTGAAAATATACAAATTGAACTG
CCTAATGTACTCTAAATGAATGAAGAGTGGATGCCCAGTGACTTATGA


>Contig17229.0.g37(protein)
MNDQKQERENNDLTEQKFQEQQQNHTHAPQKQQEQLQQESNINQTTNITNLYVINDAQFE
FKFSSQGHSIIDVSKTNQQLTSNATINQSANHLTIKQANPAATNSPQQTQNKQLQMNQSS
NQKQSQGQAANGGNIGVLGQKKMLSLGLKNRKQMVSKTSSLNPTSTVINVQGSNGNNSTP
QKHSNESLLISACVTSDKKATSVSDGTSQRNSNIKISSLVSDHKSSTLQIQNNTLVKLSN
SNKKTVQTQINSTTSSQGQSTQQNSEEDQKRVKYERTNKALKQTKKEIESSCDKILSFFI
NSVIIKCIRLAVYFSYAIIFFCSIPLQILYCSVEIMFGSCFRGNNSRDMEQRKAQGKCIK
CRSNRKTVQTQWERQQQRKLQFMIDDEDKETLTQQRKQTICKQNQDCLEDQQTQQSSCNT
NCSSSNFDKMRFTHTNKRLIVVLDLDNTLIHSVNSVPTSSDQNYFAIRDNIYVYKRPHME
YFLAEIAKFADIYIFTASMKDYADQIMDVIDPKKTFGKCFYRTDCKKDERRQIYKDLSTV
SDDLTQLIMIDDNEINCTKNPLNTFKIKHWTKSMRDDTCLKSCLSLIKYLRYSENIQIEL
PNVLQMNEEWMPSDL