Identifiers and Description

Gene Model Identifier

Contig18980.0.g97

Standard Name

FBX1b

Aliases

Contig18980_0_g97

Description

Leucine rich repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011226700.000000009996807949091551F-box domain containing protei
n
SGDYJR090C0.0005997485943342685GRR1 SGDID:S000003850, Chr X f
rom 594327-590872, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18980.0.g97(coding)
ATGGAAGAAAATTCAAAACAGATAAGCTACAAAAGCATCTTCGGACCTAAATTGATTGTG
AAAGAGTTGCTCGAATACTTTTCAATTTCTCATATTGCAAAACTTGAGGTTCTGAACAAA
TTTCTTAATGAAAAATTCAGATCTACTTATCTATCATGCTACGATAATGTTGAGATAATT
GCATCAGAATTCATGGATATTGATAAATTTTTGAACTTCATATATTGGTACGAATAAAGA
ATAAATGAGAATCCTTCATCATTCTTTCTATGCATCAACAGTTATCATATGAAGGACTAA
ATTTGCGAAAAGTTTAGAAATGAGTTTCTATAATCAATGGAGAAGCTATTCTTAAAAATG
ACATAGAATTGCAAGCAATTAAGATCATTGAGAATTAATATGGTAAGATAGCATGGTGAG
AAGGTAAATGATAGCATGTGTAATCTCATTGTGCCTTTACTTGATCAAATCGTTCGCTTT
GAGTAAGAAAGATCAGACGAGGTTTTTCTAGAAAACGTGCAAATTTAATCTACAGCCAAT
TCAGAAATGATAAGATTAATATGCATGCTTGAAAATTTAAGAATTTTAAAAATCACAAAT
TGCTCTTATCTAACTGGAGAATTTTTGTAAAATCTAAAATCAAAAAAACTATCAACACTT
GATTTCAGTAGCAGCTACTAAATTGAATATGATCAGATCTTATAATGTGTTCTAAATAAT
TCAGCAACTATTGATACACTTTATTTAGATGGAGAATATATGAGATCTGAACAATTTAAC
AAGTTAATCGAAAACTTACATGATATAAAGGAATTTGGAATATTTTTTGGCAATAAAATT
AAGGATAAGTTTCTAATCAATCTGACAGCAGTAGTTTCTCATTAGTTACTACACAAATTA
CTAATCAGAAAAGCTTAAAAATTAAACAATACAGCTTTTGAGCATTTCTTCACGGCTAAA
TTGCCAAGTCTTCGATACCTAAGATTAGATGATTGCAGATAACTATTGGATTCATCAGTT
GTTTTGATCAGCTAAAATTGCTCGAACTTGAGATCACTAAGTCTAAACTGGTGTTAGCTA
TTGCAAGATGATGGTGTTTCTTCAATTTTAGTAAAATGCAAAGAGTTGAAAAAGCTTAAT
TTAATCGGATTAAAGAAATTGCAAGATTAAGCGTTTGAAGCAGCTTTATAAATTGAAAAG
GATTTATCCACATAGAATATGGCACCGAGAACTGCATTAGACAGTTTGAAAAAATTGAAT
CTATCTGAATGCGATTACGTCAATGATTCTTTACTCTTTAAGATAAAAAGGAATCACTAA
TCTATGAGAATAATAAACTATTATAAGGAAGAAGTTGAATGA


>Contig18980.0.g97(protein)
MEENSKQISYKSIFGPKLIVKELLEYFSISHIAKLEVLNKFLNEKFRSTYLSCYDNVEII
ASEFMDIDKFLNFIYWYEQRINENPSSFFLCINSYHMKDQICEKFRNEFLQSMEKLFLKM
TQNCKQLRSLRINMVRQHGEKVNDSMCNLIVPLLDQIVRFEQERSDEVFLENVQIQSTAN
SEMIRLICMLENLRILKITNCSYLTGEFLQNLKSKKLSTLDFSSSYQIEYDQILQCVLNN
SATIDTLYLDGEYMRSEQFNKLIENLHDIKEFGIFFGNKIKDKFLINLTAVVSHQLLHKL
LIRKAQKLNNTAFEHFFTAKLPSLRYLRLDDCRQLLDSSVVLISQNCSNLRSLSLNWCQL
LQDDGVSSILVKCKELKKLNLIGLKKLQDQAFEAALQIEKDLSTQNMAPRTALDSLKKLN
LSECDYVNDSLLFKIKRNHQSMRIINYYKEEVE