Identifiers and Description

Gene Model Identifier

Contig17380.0.g43

Standard Name

FBX1a

Aliases

Contig17380_0_g43

Description

Leucine Rich repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR090C0.00000000009998509410508463GRR1 SGDID:S000003850, Chr X f
rom 594327-590872, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17380.0.g43(coding)
ATGGAAGGAAATTCCGGATCAAATCAAATAAACTCAGGAATACTGTTAATGATGTTTGAG
TTTGAACCTGATGTTGGCTTTCTCTTGAAATTGAGTATGCTAAATAAAAAACACAACTTA
TATTTCAAGAATCAATTTGAGGGTGGACTCATTAAAAGACTTTAGCATAAAGATCATGGT
GTTGTTTCTAAGAACTTTGTGAGGCGAGTTTGCAAGTATTTGGGGAAAGGACTTGAGAAA
TTAGATTTCGAATTTTCTGCAGTCAATGATCAGCATATTGAAATTACTAAATTTCCTGAG
AGTTTGAAAGAATTAAACCTTAATGGATGTAGAGAAATTTCAGAGAAGACTTGTGTACAT
CTAACTAAATACTGCAAAAACTTGATAAGAATAGAATTGTATTGGAATTGCAGAGTGATT
GACTTTGGAATTAAAAAATTAAGCTCGTCTAATCCAAATTTATCATATGTGAACTTGAGT
GGCTGCAAATATCTGACTGATTCATCAATTATTGCACTCTGCGAAAATTGCCCCGAGATA
TATCATTTGAATATTACAAGAATCCCAAAGATCACTAAGAAATCTATGGAGTCAATTGCT
TCTTTAAAGAACTTGGAGTATTTAAATCTCTATGCAAATTCGGAAATATCAGATAATGGC
TTTTAGATTCTTGCCCAATCATAATTTCATAAGTTAACTTTTCTGGATTTTTGTGGATGC
AAATATCTTTCCGATGACTCTGTAATTGCTTTATGTAAAAACTATCCTGACCTAACTTAT
TTGAACTTGACTTGGTGCGTATCTCTAACTGATAAAGGAATCGTGGATGGCATAACAGCA
TATTTATCAAAACTAAACTTACTAAGTCTCTACGGATTAGTGACCTTAACTGATAAGGCA
ATTGATGCCATTTTAAATACCAATATGAAATATACTCTGGAGATTTTTGATATTAATGGA
TGCAGAGAAATTACCAAATCGGATGAAGCTACTTTAAAATCATTGTTTCCAAATGTTAAA
GTGCTTGTTTATCATAGTTGA


>Contig17380.0.g43(protein)
MEGNSGSNQINSGILLMMFEFEPDVGFLLKLSMLNKKHNLYFKNQFEGGLIKRLQHKDHG
VVSKNFVRRVCKYLGKGLEKLDFEFSAVNDQHIEITKFPESLKELNLNGCREISEKTCVH
LTKYCKNLIRIELYWNCRVIDFGIKKLSSSNPNLSYVNLSGCKYLTDSSIIALCENCPEI
YHLNITRIPKITKKSMESIASLKNLEYLNLYANSEISDNGFQILAQSQFHKLTFLDFCGC
KYLSDDSVIALCKNYPDLTYLNLTWCVSLTDKGIVDGITAYLSKLNLLSLYGLVTLTDKA
IDAILNTNMKYTLEIFDINGCREITKSDEATLKSLFPNVKVLVYHS