Identifiers and Description

Gene Model Identifier

Contig14504.0.g56

Standard Name

FARSB

Aliases

Contig14504_0_g56

Description

B3/4 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR060W4.001580524003507e-155FRS1 SGDID:S000004050, Chr XII
from 260979-262766, Geno...
T. thermophilaTTHERM_002184108.998057044852888e-147phenylalanyl-tRNA synthetase,
beta subunit fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14504.0.g56(coding)
ATGCCAAACGTAAATGTGTTAAAGAAGGAGCTCTTCCAATTCATCGGAAAAGACTTCACT
GATGAGGAGTTCGTTAACTTGTGCTTCGAGTTCGGTTTAGAAATGGAGCAGGGAGATGCC
ACTGAGATGTAAATGACTAGAGTTGATGATAAAGGAAATTCTATTGATATCAGCAAGTAG
GAAGTTTTCAAACTTGAAGTTGCTGCAAACAGATATGATTTGCTCTGCATTGAGGGAATC
GCATAGATCTTGAGAAGCTATCTTGGTCTTGGTCAAATTCCTAGACTCAATATTAAGAAC
CAAAGAGAGGGAGGTCTTGAAAAAATTATTGTCAAACGTGAAACCATCGAAGTAAGACAG
TACGTTGTAGGTGCAGTGCTTCGTAACATCAAGTTCGATTTACAGTCATATAACTCTTTC
ATCGATTTGCAAGATAAGCTACATCAAAACATTTGCAGAAAGAGAACTCTAGGTTCAATG
GGAACTCATGATTACGATAAGGTTCAAGGCCCAATCACATATGAAGCCAGAGCTCCATAA
GATATTGTTTTCCAAGCACTTAAGCAGACTGAATCCATGAATGCTCAATAATTGTTTGAG
AAGCTTAAAACTGACTAGAAGTTGAAGAAATACTTGCATATTCTTGAAGACAAGCCAAAG
TATCCAGTATTCTACGATCAAACTGGATAAGTACTTTCTCTTCCTCCCATCATTAACTCT
GATGCAACTAAAATTGGTCTTGAAACTAAGAATGTCTTCATTGAAATGACTGGAACTGAT
CTTCATAAACTTGAAATTTGCTTGGTTATTGTTGCTGGTCTCTTCTCACAACACTGTGGA
GGCGATAGTCAGTTCACTATTGAGCAAGTAGAGGTTCATCACGAAGTTGATGGAAGAGTT
GAGGTATACCCACAACTTACCTACAATCAATTCGAAGTAGATCTTAACACTATGAACAGA
GTACTTGGTCTTAATATCGATAGTGCTAAAGCAAAGGAATGTGCCGAGAAAATGGGATTA
GTCATCAAGGATGATGGTTTAGACCAAAGCAAGCTCTTAGTTGAAGTTCCAACCGTAAGA
AGTGACATTCTTCATGCATGCGATATTATCGAGGATATTGGTATTGCTTATGGCTATAAT
AACATTCCAAGAGAAATGCCACCTACTAACACTATTGGTAAATAACAACCTCAAAATCAC
TTCACAGATTTGATCAGAGCTGAACTTGCACAAGCAGGTTACATAGAGTGCTTGACAATG
TCTCTCCTCTCAATCAAAGAGAACTACGATTTCCTTAATCATAAATTCAATGAGAACGAA
GCAGTTCAAATCTCAAATCCAAAGACAATTGAATTCGAAGTTGTTAGAACTTCCTTGGTT
CCAGGTCTGCTTAAGGTTTTCCAATCAAATACTAATGAAAGCTTGCCTCAAAGAATCTTT
GAAGTCAGTGATGTTGCTCTATTAGACGATTAAAGTGATGTCCTCGCTAGAAACGAGAGA
AGAATCAGTGCTTTGTACATGAACAAAACTTCCGGTTTTGAAGTGATTCAGGGTGTTCTT
GATTAACTCATGACTAAGATCGGAGCTAAGCATGGTCAAGATTACAAATTGCAGTAATCT
CACGATGCCATGTACTTCCCAGACAGAGGTGCTGATATCGTCTTCAACGGACATGTTATT
GGAAGCATTGGTGTGCTACACCCACAAGTCCTCGAATCATTCAATCTCAAGTACCCAGTC
ACCTCAGTCGAAATCAGACTTGACGACTTGTTCTAACACTTCAGAAATGTTCATCAGTGA


>Contig14504.0.g56(protein)
MPNVNVLKKELFQFIGKDFTDEEFVNLCFEFGLEMEQGDATEMQMTRVDDKGNSIDISKQ
EVFKLEVAANRYDLLCIEGIAQILRSYLGLGQIPRLNIKNQREGGLEKIIVKRETIEVRQ
YVVGAVLRNIKFDLQSYNSFIDLQDKLHQNICRKRTLGSMGTHDYDKVQGPITYEARAPQ
DIVFQALKQTESMNAQQLFEKLKTDQKLKKYLHILEDKPKYPVFYDQTGQVLSLPPIINS
DATKIGLETKNVFIEMTGTDLHKLEICLVIVAGLFSQHCGGDSQFTIEQVEVHHEVDGRV
EVYPQLTYNQFEVDLNTMNRVLGLNIDSAKAKECAEKMGLVIKDDGLDQSKLLVEVPTVR
SDILHACDIIEDIGIAYGYNNIPREMPPTNTIGKQQPQNHFTDLIRAELAQAGYIECLTM
SLLSIKENYDFLNHKFNENEAVQISNPKTIEFEVVRTSLVPGLLKVFQSNTNESLPQRIF
EVSDVALLDDQSDVLARNERRISALYMNKTSGFEVIQGVLDQLMTKIGAKHGQDYKLQQS
HDAMYFPDRGADIVFNGHVIGSIGVLHPQVLESFNLKYPVTSVEIRLDDLFQHFRNVHQ