Identifiers and Description

Gene Model Identifier

Contig1385.1.g55

Standard Name

FARSA

Aliases

Contig1385_1_g55

Description

tRNA synthetases class II core domain (F)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01409 ) tRNA synthetases class II core domain (F)
  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam00152 ) tRNA synthetases class II (D, K and N)
  • ( pfam13463 ) Winged helix DNA-binding domain
  • ( pfam01262 ) Alanine dehydrogenase/PNT, C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001336903.000071119766155e-172phenylalanyl-tRNA synthetase,
alpha subunit f...
SGDYFL022C2.0007442334946695e-153FRS2 SGDID:S000001872, Chr VI
from 95010-93499, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1385.1.g55(coding)
ATGGTCGAAAGAGTCGCACATTAGGAAGAATCCGCTGTTGAGCAAAAAGTACTCAACTTA
CTCAACTAAAATGAAGTTATTGAGGACACTCAGTAGCTCGCTAATGAACTTGGAATTTCA
CATGTTGAATTAGATAAGACCTTGAAGAGTTTGTTGGCTGAAGATTACGTAGTATTGCAA
GTCATTGAGAAGAAATCACTTGAATTGACTGATGAAGGAGCTCAGTACGCAGAGAAAGGT
ACTCCAGAGTATCAATACGCTTCAGCACTTTAAGTTAACACTCCCATTAACAAGGCCGAA
TTTGATAAGAGCGTAGGAGCTGAATTAGCCAAAATCGGATTTTCAAAGGCAATGTAAAAG
AAATGGGTTAGACTTGTTCCTGATAATAAAGAGCAAGTTGAAAGAATCGCCGAAAATCTT
GAAGATTCTGATAAAGATTAACTTAACAAGTACAAAACAATCGTTGATCTCGAGGCTCAT
GATAAAAAGGTTCTTGATCAAATGAAAAAGAGAAAGCTCGTTAATGTCATTACTCAGAAA
TATTACAAAGTAACTAAAGGAAGCAATTACGCTCCACGCAGAGTTAAGCTTGAAACTGAT
CTTACAGCTGATATGCTAAGAACAGGAGCTTGGAAGGATACCAAGTTCAAGAACTATAAC
TTCAATTCAGTAGGAGTAGTCCCAGAAGGTGGTCACTTGCATCCACTTCTGAAAGTAAGA
ACTCATTTTAGAGATATTCTTTTGGAGATGGGTTTCAATGAGATGCCTACTAATAGGTAC
GTTGAGAGTTCATTCTGGAACTTCGACACTCTTTTCCAACCCCAAAGTCATCCCGCAAGA
GACATGCATGATACTTTCTTCCTTAAAAAGCCAGTACTCTGCAAAGATTTCCCAGCTGAA
TATGGTGAAAGAGTTAAAAACATGCATGAAAAGGGAGGATTTGGTTCAATTGGTTATCAA
TATAAATGGGATATTAATGAAGCCAGAAAAAATTTGCTCAGAACTCACACTACTGCAGTC
AGTTCTCAAATGCTACATGCTTTGGCAAATCAAGGTGAATTCAAGCCAATGAAATATTTC
TCTATTGATAGAGTTTTCAGAAATGAAACTCTCGATGCCACTCATTTGGCAGAGTTCCAT
CAAGTAGAAGGTCTCATCGCTGATAGAAACATCGGTCTCTCTCATTTGATCTCTCTCTTG
AAGGAGTTCTATGATAAGATTGGTATTAAACAGTTGAAATTCAAGCCAGCATACAACCCT
TACACTGAACCATCAATGGAAATTTTCGGTTATCATCCTTAATTGAAAAAGTGGGTTGAA
ATCGGTAACTCAGGTGTTTTCAGACCAGAGATGCTCAGACCAATGGGATTACCAGAAGAC
GTAAGCGTCATCGCTTGGGGTCTCAGTCTTGAAAGACCAACCATGATCTACTATGGCATC
AACAACATTAAAGATTTGTTCGGCCATAAGGTTTCTCTATCATCAACCAAGCAAAACAAG
ATCTGCTATATCAATCCATGA


>Contig1385.1.g55(protein)
MVERVAHQEESAVEQKVLNLLNQNEVIEDTQQLANELGISHVELDKTLKSLLAEDYVVLQ
VIEKKSLELTDEGAQYAEKGTPEYQYASALQVNTPINKAEFDKSVGAELAKIGFSKAMQK
KWVRLVPDNKEQVERIAENLEDSDKDQLNKYKTIVDLEAHDKKVLDQMKKRKLVNVITQK
YYKVTKGSNYAPRRVKLETDLTADMLRTGAWKDTKFKNYNFNSVGVVPEGGHLHPLLKVR
THFRDILLEMGFNEMPTNRYVESSFWNFDTLFQPQSHPARDMHDTFFLKKPVLCKDFPAE
YGERVKNMHEKGGFGSIGYQYKWDINEARKNLLRTHTTAVSSQMLHALANQGEFKPMKYF
SIDRVFRNETLDATHLAEFHQVEGLIADRNIGLSHLISLLKEFYDKIGIKQLKFKPAYNP
YTEPSMEIFGYHPQLKKWVEIGNSGVFRPEMLRPMGLPEDVSVIAWGLSLERPTMIYYGI
NNIKDLFGHKVSLSSTKQNKICYINP