Identifiers and Description

Gene Model Identifier

Contig16741.0.g68

Standard Name

FARS2

Aliases

Contig16741_0_g68

Description

tRNA synthetases class II core domain (F)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01409 ) tRNA synthetases class II core domain (F)
  • ( pfam03147 ) Ferredoxin-fold anticodon binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006782501.9999788875029746e-125phenylalanyl-tRNA synthetase f
amily protein
SGDYPR047W5.002432061182517e-99MSF1 SGDID:S000006251, Chr XVI
from 657529-658938, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16741.0.g68(coding)
ATGTTCATGTAAAAATACCTAAGGACAACTTTCCTTTAACAATCCTCAATGTTGAAAAAT
TCTTAACAACTATCCCAAAGAGCATTTTCAACAAATTTTGAAAAAGATTCTTTCAATAAT
ATCCCACAGGGTATTACTGACTTGACAGGCAGAAAGATTTATAAATAACCAAATCACCCA
CTCAACACTCTCATTACCAAGATCGAAGATTTCTTCTAAAATTAAAAGTTTAGTGATTTG
TAAATACCAGGAGAGAAATTCAAAGTTTTTAAGGATTTTGAACCATATGTACAAATTAAA
GAATGCTTTGATGATCTAGGAATTCCTGAGGATCACGTATCTAGAAGAGCCTCTGATACT
TACTATCATTCAAAGAATATCGTTTTAAGACCCCACACCTCAGCTCATTAAATTCCCTTA
ATGAAACAAGATAATTCAGCTTTCCTAGTTCTTGGAGATGTCTACAGAAAAGATACAGTT
GACAAGACTCACTATCCAGCTTTCCATCAAATGGAAGGTGTAAGAACTTACTCTCTAAAA
GATATTGGGGCTAAAGATGTTAAAGAAGCAAAGATTATTACAGAGAGAGATTTAAAACAA
GTTTTGGAGAATTTAGCTAAGCATTTATTCGGAGACGTCGAAATGAGATGGGTTGAGGCA
TATTTCCCATTCACTGAGCCTTCAATTGAACTTGAGATATTTTATAACAATGAATGGCTT
GAAATCCTAGGATCAGGGGTCATTCATGACAATGTTATGTTGAGAGGAGGAAGGAACATT
GATACAGAAGTTGGCTGGGCTTTCGGTCTAGGTTTAGAAAGATGGGCAATGAAACTTTTT
GACATCAATGATATTAGATTGTTCTGGAGTAAAGACGAGAGATTCATAAATCAATTCAAG
CAAGGAGAGATAACAAAATTCAAACCCTACTCAAAGTACCCTGCTTGTTACAAGGATATA
GCTTTCTGGATCCCATCCCCAGTAACTGAGACAAGTTTCAATGAGAACGATTTCTTTTAC
TTAGTGAGAAATGAGTCAAACGATATGGCAGAGACAGTGGAAATGATCGATGTTTTTACT
CATCCTGTTAGTAAAAGAGTTAGTAGATGCTATAGAATTAACTACAGAAACATGGATAGA
TCACTTACTAATGAAGAAGTTGATGCTCTTCAAATTAAAATTAGAGGACTCGTAGAAACT
GAACTAGGTTGCGAATTAAGATGA


>Contig16741.0.g68(protein)
MFMQKYLRTTFLQQSSMLKNSQQLSQRAFSTNFEKDSFNNIPQGITDLTGRKIYKQPNHP
LNTLITKIEDFFQNQKFSDLQIPGEKFKVFKDFEPYVQIKECFDDLGIPEDHVSRRASDT
YYHSKNIVLRPHTSAHQIPLMKQDNSAFLVLGDVYRKDTVDKTHYPAFHQMEGVRTYSLK
DIGAKDVKEAKIITERDLKQVLENLAKHLFGDVEMRWVEAYFPFTEPSIELEIFYNNEWL
EILGSGVIHDNVMLRGGRNIDTEVGWAFGLGLERWAMKLFDINDIRLFWSKDERFINQFK
QGEITKFKPYSKYPACYKDIAFWIPSPVTETSFNENDFFYLVRNESNDMAETVEMIDVFT
HPVSKRVSRCYRINYRNMDRSLTNEEVDALQIKIRGLVETELGCELR