Identifiers and Description

Gene Model Identifier

Contig10871.0.g27

Standard Name

FAP7

Aliases

Contig10871_0_g27

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL166C2.0008536325002377e-42FAP7 SGDID:S000002325, Chr IV
from 164042-163449, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10871.0.g27(coding)
ATGGAACAAGCAGCAAACATTCTACCAAATATCTTAGTGACAGGTACCCCAGGAGTAGGA
AAGACCTCCCTCTGCACTTTACTAGAAAACTAATTGCAGGAAGAACATGAGATATCAGGT
TTCCAATATGTGAAATTAACCGACTTAATTCAATAGAAAAAACTTTATAAGAAATGGAAT
GAGGAATTTGATGTTCCAGAATTCGATGTAGACATGGTCTGTGATGAGCTTGAACCACTG
ATGAGCGAGAGAGGTGGAATTATATTGGAGTTTCACTCTTGTGATTTTTTCCCTGAGAGA
TGGTTCTAACTAGTAGTTCTTCTTAGATGCAATAATACTGAACTATACGATAGACTTCAA
GCAAGAGGCTATAATGAGAAGAAAATCACTGAGAACATAGAATGCGAGATATTGGATGTG
CTTAAAGAAGAAGTAGATTAAAGTTATGTTTCAGAAATAGTTATGGAATTGCAATCTGAT
AAAATTGAAGACATGCAAACCAACATTGAGCATATTGTTAATAGAATTAAGAGATTAACA
GGAAGAGTATGA


>Contig10871.0.g27(protein)
MEQAANILPNILVTGTPGVGKTSLCTLLENQLQEEHEISGFQYVKLTDLIQQKKLYKKWN
EEFDVPEFDVDMVCDELEPLMSERGGIILEFHSCDFFPERWFQLVVLLRCNNTELYDRLQ
ARGYNEKKITENIECEILDVLKEEVDQSYVSEIVMELQSDKIEDMQTNIEHIVNRIKRLT
GRV