Identifiers and Description

Gene Model Identifier

Contig1332.1.g124

Standard Name

FANCM

Aliases

Contig1332_1_g124

Description

Type III restriction enzyme, res subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam04851 ) Type III restriction enzyme, res subunit
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00270 ) DEAD/DEAH box helicase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005354701.9992362000979228e-56Type III restriction enzyme, r
es subunit fami...
SGDYIR002C2.000704504372864e-47MPH1 SGDID:S000001441, Chr IX
from 360396-357415, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1332.1.g124(coding)
ATGTAACTAGGATAATCTTGGTTCTTGGGTCTATCCAGTTTCAAAGACCTTCAGAACTTA
TTAGTTCAGAATTTTACCTTACCCACTGGTCTTGGAAAAACTTTCATTGCCTCAACTACT
ATGTTTAACTATTACAGATGGTTTGATGATGGGCTGATATTCTTTTTAGCTCCCACAAAA
CCACTTGTTACTTAACAAACAGAAGCATTTGCTTAAGTCATCTCCGAAGTTCCACTTGAC
GACATTATAGAGTTAACTGGTAATCAAAACAAAGATAAGCGAAAGATAGCATACAGATTA
AAGAGAGTTTTCTTCATGACTCCCTAAACACTTCAGAAGGATATTGAGAATAATATTCTT
GATGTGAAAAAAATCGTTTTGTTGGTTATAGATGAAGCTCACAGAGCCACAGGAAACTAT
GCTTACTGCAGAATAATTCAGTTACTTGAGGAGTAGAACATTGGATTCAGAATTGTGGCA
CTTTCTGCCACTCCTGTCTCCAAGATAGAAAACCTGCAAACTGTAGTTAACAGCTTGAGA
TGCGCCATGCTGGAGGTAAGAGACGAAGAGGATGAGGAAATCAAGCAATATACTCATGGT
AAAGATATTGTTGAAATTCTAGTAGAGAAAGAAGATCACATCACAGAGATGGAACTCAAA
ATTATGAAGCTTATGGCTTTGGCTCTAGCTTTTCTGAAGCAAATGCAATTAGTAAACCAA
AACATGCAGCCTAAGTTCATAACTAAAATGAATCTGCTGAACCTTTAAGATGAATTTAGA
GGCAAGATGCCAAACTTTGCTCCCTCTATGATTTCCTGCGTATTTGAAAGAGTCTCTTTT
CTGTTGAGTATGTGTCATGCCAAGCAGCTTCTCGCAGTTCACGGCACTGAATCATTTAGC
GATTACATAGTAAACTTCTTTGATGTAACTAAAAAGGATAAAAAGCATGTTAACTTCATA
AAAGCTATCAAGGAAAGCGAAGACTACAAGGATATGATAAGCTACATTGAAGAAACTAAA
CAAACTAAAAATCATCCTAAATTAAAGAAACTATCTGAAATCTTGGATCTATTTTTCAGA
GATGAAACTCATAAAGACTCCAAAGTCATAGTATTTTCATAATTCAGGGAATCAGCAAAT
GAAATAAAGAGATATCTGGTCAGGAAAAATGAAGGAGTAGTTCATGCAGAAGTTTTTGTT
GGCTAAAATAATAATGGACTTTCCTAGAAAGTCCAAGCTGCAATGATATAAAGATTCAAA
ACAGGAAAAACTAATACTTTAGTTGCCACATGTGTCGCAGAAGAGGGTCTGGACATAGGA
AACGTAGATTTAATTATCAGTTATGACTGTCTAGCCTCACCAATTAGAATGATTCAGAGA
TTCGGAAGAACTGGAAGAGCAGGATGTGGACAAGTTATCGTCTTGATTGCCAAGGGTGAA
GAGGAAAACAAATTCAAAATGTCAAGAAAGAACAGCAAGTTGATTATGAATGCGATTAAA
CATCAATCTAAGCTCATTGAACACTCAAAGCAGCAAAATGAATCAAATCTCTAACAACCT
GCTTCATAAGCTAAAAATGGAAGTAAACAAACTAAGCTAAATTTTGGCTAACCTGCACAG
TAATAAGTCATGCCAGCTCTTCAAGAATATCAAAAAGTTAAAGAGCCTACTTTGTAACTC
TACTCATTTAATCCAAGAATGATTCCTGAGGAGATTGATCCAGTTCCTATGTTAAGAAAA
CTCTTACCAAGAACTGAAGAGGAGCTCGAATAATTTAAGAACAGTGAAAATCAGACTAAG
AAAAGAAGATCAAAGTCAAAGGAAGAAAACAAGACTAAGAAAACAAAGAAAAACTAGATT
AATGATGAAGAAGAGGAATAGAAAGGATAAGGGGATTAGTAAAAGAAGAGAGGTCGTAAG
AGAGGAAAAACAGTAGAGCAAAGAGATAGTGAATAAAAAGAAGAAAGAAAGTTAGAGTAG
ACTGATAAAAAGAGTGACTCTCCAAATAAAAGTAATGATCAATCTCAAGTCAAGCCTTTA
TCAAGAAGAGAAAGTTAAACTCCATATAATAGAAGGATTTCACTTGGAGGACCTCCAATT
TTAATCTAACCATAAGTTCAGGAGGACGATGGGTTGGACGACTATTTTATATAAGAAGAA
GAAATTACAGAATTAAACCAAATTGTTTAATCTACAGAGGAGTAACAGGAGCAACAGTAA
AACCTTGATAAAACTTTCTAACAGCTTGATGACTACCTAAACTAGAGTGTTACTGTAACA
AACATATCCAGTCATTAAAAAAGCTTAAATGAGACCTTGAACTTTGGATAGACCTCCAAC
GATTAAAGTATGCTTTTATAGAATATCATTAGAAATAACCAAAACTTAATGGCTTCTAAT
TCGCCTCAGGTAAACTTGGAAGAAGAAAAGTAATAAAGTTAATAATAATTTGATGACGAT
GATTTGGACGACATTGATTTGAATGATATTTCAGAATTGAATGATGATTTTTGGAAAGAA
ATAGAGTCATTTATTAGCGATTTATCAGATTAACGCCGCAAGTCTAAAGTTAGAAAATCA
TATGAAGGGAGAGATGATAATGAAAGTCAAAATAATAGTGATAGTGAAAGTTTAACAGGT
AGTTCTAAATAGCCTGGTAAAAAGAGAAAAATCAATAGTGGTGATATTGAGAATAAATAA
TGA


>Contig1332.1.g124(protein)
MQLGQSWFLGLSSFKDLQNLLVQNFTLPTGLGKTFIASTTMFNYYRWFDDGLIFFLAPTK
PLVTQQTEAFAQVISEVPLDDIIELTGNQNKDKRKIAYRLKRVFFMTPQTLQKDIENNIL
DVKKIVLLVIDEAHRATGNYAYCRIIQLLEEQNIGFRIVALSATPVSKIENLQTVVNSLR
CAMLEVRDEEDEEIKQYTHGKDIVEILVEKEDHITEMELKIMKLMALALAFLKQMQLVNQ
NMQPKFITKMNLLNLQDEFRGKMPNFAPSMISCVFERVSFLLSMCHAKQLLAVHGTESFS
DYIVNFFDVTKKDKKHVNFIKAIKESEDYKDMISYIEETKQTKNHPKLKKLSEILDLFFR
DETHKDSKVIVFSQFRESANEIKRYLVRKNEGVVHAEVFVGQNNNGLSQKVQAAMIQRFK
TGKTNTLVATCVAEEGLDIGNVDLIISYDCLASPIRMIQRFGRTGRAGCGQVIVLIAKGE
EENKFKMSRKNSKLIMNAIKHQSKLIEHSKQQNESNLQQPASQAKNGSKQTKLNFGQPAQ
QQVMPALQEYQKVKEPTLQLYSFNPRMIPEEIDPVPMLRKLLPRTEEELEQFKNSENQTK
KRRSKSKEENKTKKTKKNQINDEEEEQKGQGDQQKKRGRKRGKTVEQRDSEQKEERKLEQ
TDKKSDSPNKSNDQSQVKPLSRRESQTPYNRRISLGGPPILIQPQVQEDDGLDDYFIQEE
EITELNQIVQSTEEQQEQQQNLDKTFQQLDDYLNQSVTVTNISSHQKSLNETLNFGQTSN
DQSMLLQNIIRNNQNLMASNSPQVNLEEEKQQSQQQFDDDDLDDIDLNDISELNDDFWKE
IESFISDLSDQRRKSKVRKSYEGRDDNESQNNSDSESLTGSSKQPGKKRKINSGDIENKQ