Identifiers and Description

Gene Model Identifier

Contig12035.0.g89

Standard Name

FAN1b

Aliases

Contig12035_0_g89

Description

VRR-NUC domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12035.0.g89(coding)
ATGCAATTACTGTAAAAGGCTCAACAGGAAACTTCGGAAAATCTAATAGTGTATTTTACA
GATTTCCCATGGTTTTTAGGCAGAAAATACTCTATAGAAAGCAATTTGAAGCTAATCATC
GAAAAGTCAAAGATATAAATATTAGCAATCAGAACTCAAAGTAGCAAGAAGAGTCAAAGA
TATTCTTAGAATAAGACAAAAGTCTACTTAAATGCCAGCATGCCATAAAAATAGTGTTCT
CATGATAGATCTATCAAGGAGAGGATGAGTCAAATAAAGGCTTAATTGAAGAATATGATT
TAGGATATTGCTGTAGGATTCTTAGATCATATCTTAAAAGATCAGAAAATTAAGGATAGT
GCAATTAGTGATAAAGTTGAAACTCAGTGTTCCAGTTATAGCGTCAAAGATTTCTGGGGA
ATGCCTAAAGTACTGTAAACTGCCTTTAAAATGATAAATTAGTACAATATCAATAAAGAA
GTTGGGTTTGAGTTCTACATCAAAGATTCAAATGAGAACGAAGAATAATCTGACTTATAA
ATTAATAAAACTGAAGAAGATTCGACTTTTGACTATTTTAAAGAGTTCGTACCTCCTGAT
AACTTATGCCTCTCCTAGGTTGAAATTAGCCAAGAACTTTTAACTTCGATTAAAGATGAA
ATTCCTAATCAAGCATCGAATTAATTTTCTCAGTAGTCAACAACAAATGAATCTACACTA
TATGTTCGTAACTTTGATCTTGTCCTTTAGACAGTCTTCAGTTACAGCAATCTTTTCACA
GAAGAGGAAAAATGCAAAATTAAATTGTTCTTAGCTTAGGATGGCAAAGCAAAAACTATC
TATGCTCGAATGTTTTTTAGAAGAAGATACTGGTTCAACAAATAAATCTTGTCTAAATAC
TCTCAAAATTAAGAATATTTAGAGGATACCGCATAAAATCTTTATAGAAATGGGTTCTTG
AGGAGTGATGAAGATGTTATATATGAAGGGGATTTTGAAAGAATAAATGAGTTAATAGAG
AATGGGATCAACGTGTGTGGATTAAAAATACTAGAAACTGAGTTAAAAAAGATAATAAGA
GGTAACCATTTTTAAGAACTAGAATAAGACTTTGATTTGATTAGAGTGAACACTTTTTAT
CAACAGAAATAAACTTTTGAAGGGAAATATGGACCAGTATGTGAAAAATTGTCTGCAAAA
ATTTCCAAATGGATTCGTGAGATAAGCGAAGAGAATATTATTAACGGAAAGAAAGTTCTT
TTCTTTAGAGACAACGCTTAGACTGAAAAACTCAAAATATGCTTGAGACTCTTCTTTTTC
TATCAGAAAAAAGATGCCTATGAAACCCTTCTAGATCATGACTATGGCTTTTACAGATAT
GAAAGTTTCAAGAATTATCTGAGTAACAGAGAATCAGATCCAAATAACGATAACTTAAAG
CCTATCTTTCAGTGCAGAGAAGATTTCTTGGCTTTTGATGAGGCAAGTCAAGTAATAGGA
AGTACTTTTGAGTTTTTATAAATGGGGCTTAAACGAAGAGATATGGAAGCTAAAGTGGCA
AAGAAAATTATCAAGCAAGCTCTAAGAATGTGTGAAATAGAATTTAATAAGAATGACTAA
GACTTTTTACTGTTTAACAATATCAAGCAACTTATCGAAGATTAGTAAGAGGAAAAGAAC
AAGTGCTACGCTTTGAGTTCCATAACACTGATTTGCCTTCTCTAGAATAAAATCTTCTAC
ACTTAAAGAGGCAAATGGTGGCACAGATTAGCAATGAATTTAAAGCATATTAAGCAAAAG
AACGAGGCATTGAAATGTTGTGATATTGCTATTAAAGATGAATTTGTCAAAGGAGACAAG
AGAAACATGATTCTGAAGCTAAGGCTTAACTTATTTGTAGAGATTAACAGACAAAACGGT
AAAATATTAATAAAAAATAGTAAAGCATTAGCCAAGAAAAATCAAAAAGGCAAGAAAAAA
GGAAAGGGATCTAAGAAAAATGCTAATATAGAGATGATGGAGGATTTTAACAAATCCTTT
TTAAAGTCTTAGTAAATGGTTAAAGATACAAAAAGAAAGTTTAATAGAATCTCAATGCTT
AACAATTTTCTGGATGATGAAGAAGAGGCATAGAATGGATACTCCAGATCAAAACCATTT
GTCTTAGACGACTATTCTGATGATGAAGAATAACTAAACAAAAAGCTAGTAGGGAAAAAA
CGAAAGAAAAAATATACTGATTAGTACGATGAAGAAAGTAATATCTAATCTTCTGTCGAG
GAAAACTCAGATACCGAACTTGAAGATTACAAAAGCAAGCTTTTGTTTTAGAACACCCTA
GATTAGAAAAAGAGTGAACTAAGGGATTTAACGCTTGAATATAAAAACAGTGAGAGTATA
AATGGAAACATAGAGTATGATCCTATCTTGAACCCAGATGCTATCATTGAAAATGAGAAA
AGGATGACATTTGAGCTTTTGTCGAGATCGGTTGAGTAGAAAATCGATAAAAGATACTTT
AAGGAAGTTATTCTTAATGCAAAGAGAAATTTTCAAGGTGATCACATGAAATCAGTTTAT
CTTGATAAGAAGTCTAACCAGTTCTTTAATGTTGAGAATTTGGCACTTCATTACTATGGT
CAGAAATTAAGATGGAATGGAGCCCATGTTGAAAATGCATTGATGAAATATATGTATGGA
ATCATGATGTGGGATGAAATATTTAATGACAACATTCCCTATGTCTTTTAAACACCTTAT
CAATTTCAACCTCTAGATTTTGATTACCCAGAATTCTACTATCATAGAAAAGACATTATT
GAGTAGAAGTTAAATAGAATAATTGGAATGACTCGAATGTAGATTAAAGAGTATTTAATC
TCTGAGTATGATAAGCACAAAAACTTTCATAACCCAATTGTGAATTGGGACAATATAAAA
CTAACTAAGCAACGTATGGGTTCGATTGCTTATTGCATGGGAGGCCCACTAATTGCTATG
TTCTTTAAAAAACTAGCTCAAGATTTCTAAAACTGGTGCTACGGCATGCCAGATTTAGTT
TTATGGAGAGAGCACAAAGGGGAGATTAAATTTGTAGAAGTAAAAAGTGAGAATGATACA
TTAAGTGAACAGTAGAAATGCTGGATATTAAACATCACTGAATGCGGGGTTGAGGTAGAT
TTATGTTGGGTAACTGATAAAATAGATGGAGTAGATGTTTTCTGA


>Contig12035.0.g89(protein)
MQLLQKAQQETSENLIVYFTDFPWFLGRKYSIESNLKLIIEKSKIQILAIRTQSSKKSQR
YSQNKTKVYLNASMPQKQCSHDRSIKERMSQIKAQLKNMIQDIAVGFLDHILKDQKIKDS
AISDKVETQCSSYSVKDFWGMPKVLQTAFKMINQYNINKEVGFEFYIKDSNENEEQSDLQ
INKTEEDSTFDYFKEFVPPDNLCLSQVEISQELLTSIKDEIPNQASNQFSQQSTTNESTL
YVRNFDLVLQTVFSYSNLFTEEEKCKIKLFLAQDGKAKTIYARMFFRRRYWFNKQILSKY
SQNQEYLEDTAQNLYRNGFLRSDEDVIYEGDFERINELIENGINVCGLKILETELKKIIR
GNHFQELEQDFDLIRVNTFYQQKQTFEGKYGPVCEKLSAKISKWIREISEENIINGKKVL
FFRDNAQTEKLKICLRLFFFYQKKDAYETLLDHDYGFYRYESFKNYLSNRESDPNNDNLK
PIFQCREDFLAFDEASQVIGSTFEFLQMGLKRRDMEAKVAKKIIKQALRMCEIEFNKNDQ
DFLLFNNIKQLIEDQQEEKNKCYALSSITLICLLQNKIFYTQRGKWWHRLAMNLKHIKQK
NEALKCCDIAIKDEFVKGDKRNMILKLRLNLFVEINRQNGKILIKNSKALAKKNQKGKKK
GKGSKKNANIEMMEDFNKSFLKSQQMVKDTKRKFNRISMLNNFLDDEEEAQNGYSRSKPF
VLDDYSDDEEQLNKKLVGKKRKKKYTDQYDEESNIQSSVEENSDTELEDYKSKLLFQNTL
DQKKSELRDLTLEYKNSESINGNIEYDPILNPDAIIENEKRMTFELLSRSVEQKIDKRYF
KEVILNAKRNFQGDHMKSVYLDKKSNQFFNVENLALHYYGQKLRWNGAHVENALMKYMYG
IMMWDEIFNDNIPYVFQTPYQFQPLDFDYPEFYYHRKDIIEQKLNRIIGMTRMQIKEYLI
SEYDKHKNFHNPIVNWDNIKLTKQRMGSIAYCMGGPLIAMFFKKLAQDFQNWCYGMPDLV
LWREHKGEIKFVEVKSENDTLSEQQKCWILNITECGVEVDLCWVTDKIDGVDVF