Identifiers and Description

Gene Model Identifier

Contig19620.0.g100

Standard Name

FAN1a

Aliases

Contig19620_0_g100

Description

VRR-NUC domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19620.0.g100(coding)
ATGATTAATGGTCAGAGTTATAGTAAAAATAATTCTGAGACAAAGTAGAAAAATTTATAA
GAAAATGTTATTGAAAACACTGTTTAAATTGATACAAATATAGAAAACTCAAAGACTCTG
CCAACAAATAATGGAGACGTAAATAAACAAGAAGTTGATGAATAGCCATTCATAAACTCT
ATAAAATCTGAATAAATTGATGCTGAAATAGATACCATATAGATTTAAACAGAGACTCTT
GATGACTAGTATATGTAAAAGTTTTACCTCGGTTATGTCCCTAAAGATATAGCTTACAAT
CTTTCTCAACTCTTAGACAGTAAAAATGTATTTTACCAATAAAACCTAGTTTATATTCCA
CCTAAGCAAACGAAGCAATCTTTTATTGAAGTTGAACTCAATCTTAAATAAAACGTGTTA
AAAGATTAAAGAATGAAATCAGGTTAGACATTTCTTTTGAAAAGTTTCCCTGGAATGCCA
GCTTCTTTAAAGCAAGCACTCTTCGCTGTGAATAAATTCAATTTAAACAAGGAGTTTATA
CATTCAATAGACCCTGAAGATCCTGATGATGAAATAAATGAGAAAAATTCTTCGAGCTTC
GATATTTTTGGAGACTCACGTGGAAAAGAGAGTCCTAGTTAAAATAATAGGTCTGCCACG
AGTAGCAAAAATAAGGATAATAACTTTGGGCAGACAGAAGAAATTAACAAAGAAAAGAAC
AAGTACAACAGGAATTTCATATTAGTGATTGAGACAGTTCAAAATTATGGTAATTTATTT
TCAGAAAAGGAAAAAGAAATGCTTGATACTTATGTTAATAAATTATCTCCAGAAGCTTAA
ACTATCCTAGCTAGATTGATGCTAAGAAAGAGAGTATGGTTTAACTAAGCTGAACATTTG
GCAAAATATATTAATGATGACATTATTATACAATAATCCCTAGACGAGTTAATCTAAAAA
GATTTTATCATACCCGATACTCATTTAGGTGATGACATCGTACACTAATTAAAATCCCAA
TAAAAGTCTCTCCCTCCAAGACTTGAAGATATATCTGAGTTTCTAGAATCATTAAACATG
TAAAAATTGCTTGACATCAATAAATTAGTGAATAAGTTGATTAAAAATGTTAAAATTGAA
AACTATGTAGATGTCTATGAAGTTTCTCAAAACCCTTTTATGAAGCTGAATTACTACTTA
AAAGCTTTCTAATAGCAAGATGATGAGAATATTAATCTTAAGCTGTAGCAGTTGATTAAT
TTGAATGAAAAAATTGCAATTAGATTTTCTGGCATGATATGTGAGTATATACTTGAAAAT
TTGAATTAGAGTATGAATATGAGCTTGCAAAATGGTAATTAAGCCCAACATAATTTACTT
AGATTTTTCAGTTTTAAATAATAGAATTAAGAGAATGAGGATATGAGTGATGAAGATAGT
TAAACCTCTAAAACTTCTGAAGTGTAGATAAAGAAAGCTGTTAATTTTAAATAAGTTCAA
AAGATCGAAGAGAAATTGCATGAATTCTTTAAAGGTGTGAGATTTATAATAAATGGAAAC
GGAGATCAAATGCTGTTTAAAATTGACAATAAAATCTTAAATTTACTTAATAGGTGCATG
AACTTATTCTTTTTCTACCAGACCAGTGATCCCTTCGAATAATTGAATATGCATGATTAT
GGCTTTTATTAATACGAAGAATTTCAAAATTACTTGACTTATCAAAATCAAATCAAAACT
AAAAGTCGAAAAGAATATGCTTAGTATTTAAAACCTATCTTCAAGAAGAGAAATTAGTTC
ATAAAGTATGATGCTTTTACTCAGTTATAAGTCGCTTTTGAATAGGTGAAAGAAATGAAA
ATTAAAAAGCCAAGTATTCTTGGAACCCTTTGCAGGAAACTTTCAAAATATCTTATTAAG
GAGTATGCCAAACAAGACGAGGAAGTTAATTTAAACAAGGATGAGATGAAATGCCAGATT
TTAGACAATATCAAAGTCATAGTGGAGAATACAAAGAAACCAGATAATAATATATAAATT
AAAGAGCCACTCTTCATTTTGAGATATAAAACAAGTTCTAAAATTGCAGGGGTTCTCAAT
CAGTGTATAGATTTCTTGGAGAGAGATCGGCAGTATGATGTTGCATGTAAATGGTGGGTC
AGATTATGCATTGACTTAAAACATCTCAGAATGAGAAAAGAATGTTTGAAAGTTGCCGAA
CATGCTCTATTAGAATCCAGTTGGGTAAAAACTGGGTCTAAGAATGCTTTGTTTAGGATC
AAAGAGCAACTAGCGAAATCATTTAATAGACAAACTAGCAAATAAACCACTAAGAACAGA
AGGACTAAGAAGAGTGAAGATGTATCAATATTTCAAGACGAGGAAGAGAAAGATTCTGCT
GAAGATAAAAAATAGAAGTAAAACATGCTGGCAATTGAATAACTTTTTCAAGATGTTATT
GCTTCTTAAAAGAACAATATCCTTATGACTTAGCTAAATTCTCAAATTCACAAGTAGATT
AACCCCGATTTGACAGATCAATATTAAATCTTGAAAGAGGAAGCAAATCCTGAGTATTTT
AAGGAGGTTTATATTCGTTGCAAGAAAGGATTAACTTACTAATACTAATAAGAATAAATA
TTGGGGTCTTCTGATATGTAGAGACCAACTTATCATAATCCATTCAAGAACGAGTTTTAT
GATGTAGAGAATTTAGCCTTGAGATTTTACTCTTTACATCAGAACTTAAATGGTATGCAT
TCTGAAAACGGACTTGGTACTTCATATTTTGGCATCTTAATGTGGAATGAGATTTTTTAT
GATAAAATACCCTATGTATTTCAAACTCCTTACTAGGCAGCCCCACTTGATTTTGGCACC
AAAGATTTTTACTAATAAAGATAAGAAATTATTGACGATAGACTTATGAAGATTTCAGAG
ATGAACAAGTTATAACTTACTGAGGACATTAGCAAGTTATACGAAGCTAATAAAAATAAG
TTTAATTAGTTTATTAATTGGGATTCTTTGAGATTGAATAAACGTAGACTTATAGAGATT
GCTCAAGTTATTGGGGGTTTACGTTTAAGTCGCATTCTTTCCAATTATTGCAAAGATTAC
AAACACTGGAATCATGGAATGCCTGATTTAATTCTCTGGGACGCCAAAACTGGAAGAGTA
AAGTTTTCTGAAGTAAAAAGTGAAACTGACAGGCTTAGTGAAGTATAGAGAGCCTGGATT
GCTTTCTTCAGTTAGAATGAAATTGACGTGGAAGTTTGCTACGTCAACCGACTTCCTCAC
TAAAGAGAGACTAGAGATAGAGAACATGAAGAAGAAAATAAGGAAAATGATGAAGAGGAT
GAAGTAGAAATATATGATGTCTTTACTGAGGAATTAAATTGA


>Contig19620.0.g100(protein)
MINGQSYSKNNSETKQKNLQENVIENTVQIDTNIENSKTLPTNNGDVNKQEVDEQPFINS
IKSEQIDAEIDTIQIQTETLDDQYMQKFYLGYVPKDIAYNLSQLLDSKNVFYQQNLVYIP
PKQTKQSFIEVELNLKQNVLKDQRMKSGQTFLLKSFPGMPASLKQALFAVNKFNLNKEFI
HSIDPEDPDDEINEKNSSSFDIFGDSRGKESPSQNNRSATSSKNKDNNFGQTEEINKEKN
KYNRNFILVIETVQNYGNLFSEKEKEMLDTYVNKLSPEAQTILARLMLRKRVWFNQAEHL
AKYINDDIIIQQSLDELIQKDFIIPDTHLGDDIVHQLKSQQKSLPPRLEDISEFLESLNM
QKLLDINKLVNKLIKNVKIENYVDVYEVSQNPFMKLNYYLKAFQQQDDENINLKLQQLIN
LNEKIAIRFSGMICEYILENLNQSMNMSLQNGNQAQHNLLRFFSFKQQNQENEDMSDEDS
QTSKTSEVQIKKAVNFKQVQKIEEKLHEFFKGVRFIINGNGDQMLFKIDNKILNLLNRCM
NLFFFYQTSDPFEQLNMHDYGFYQYEEFQNYLTYQNQIKTKSRKEYAQYLKPIFKKRNQF
IKYDAFTQLQVAFEQVKEMKIKKPSILGTLCRKLSKYLIKEYAKQDEEVNLNKDEMKCQI
LDNIKVIVENTKKPDNNIQIKEPLFILRYKTSSKIAGVLNQCIDFLERDRQYDVACKWWV
RLCIDLKHLRMRKECLKVAEHALLESSWVKTGSKNALFRIKEQLAKSFNRQTSKQTTKNR
RTKKSEDVSIFQDEEEKDSAEDKKQKQNMLAIEQLFQDVIASQKNNILMTQLNSQIHKQI
NPDLTDQYQILKEEANPEYFKEVYIRCKKGLTYQYQQEQILGSSDMQRPTYHNPFKNEFY
DVENLALRFYSLHQNLNGMHSENGLGTSYFGILMWNEIFYDKIPYVFQTPYQAAPLDFGT
KDFYQQRQEIIDDRLMKISEMNKLQLTEDISKLYEANKNKFNQFINWDSLRLNKRRLIEI
AQVIGGLRLSRILSNYCKDYKHWNHGMPDLILWDAKTGRVKFSEVKSETDRLSEVQRAWI
AFFSQNEIDVEVCYVNRLPHQRETRDREHEEENKENDEEDEVEIYDVFTEELN