Identifiers and Description

Gene Model Identifier

Contig13213.0.g97

Standard Name

FAM120C

Aliases

Contig13213_0_g97

Description

Reovirus sigma C capsid protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13213.0.g97(coding)
ATGATTGTAGCCACTGCTACAGTTTTAGTAACATCACCTGCTAACGCAATTAGAAACAAA
TTAGCACACAGCATCGGTGAAAGAAATTTGGTTTAGATGAGTGGAGGCGGCAGCGGAGGA
GCTGGAAGCAGCGGAGATAGTGGAAATGATGGAAGCTTCCTTTCAAGCAATGACTACCAA
TGGAGTGACTCTGCCCTATCAGATTGGATAGACAAACTTAACAGCGGTGAACAACTAGGA
AACTGTAGCTGTGAAGTCACTACCACACCTGCTGCTGAAACAACATAAGTTGAATGTACA
ACTGCCGCACCTGAAACTACTGCTGCACCAGAGACAACTGCAGCTCCAGAGACAACCGTA
GCACCAGAGACAACTGCAGCACCAGAAACAACCGTAGCACCAGAGACTACTGCAGCTCCT
GATACAACCGCAGCCCCAGAAACAACTGCCGCACCAGAGACTACATAAGCTCCAGAAACT
ACTACTCCAGAGCCTACACCAAGCTTCCCAAGCAATGAAACACCTACTCCAGAGCCAACT
TGCACTTGCGAGGAATAATGCAGTGCAGATAATACTGCAAATGATATGTACAATCCCGAG
TATGATTGCAACTGGGTTTATAATTCTGACATGGAAGCTTGGATGTGTATTAAACAAAAC
TGCACTTGGAATTTCGACAACAGTACCTGCATGTGGCAATGTATCGATAATGTAGTACCA
CCCTCTAACACCATCCCACCTTCAAGCAACGGTACTTGCAACTACACTTGTGAAGAAATC
TAAAATCTCTTCTCTTCAAACGAATTGCTCCAGGGTCTCGTTTCAACATTATATGAAGAA
GTTTCATCTCAAAGAGACTTCATCAATTAACTCGCAACAGATCTCCAAAGTGCAGGAACT
GCTATCGGTGCTCTTCTTGAACAATAAACCTCTATGGGACAAGCTATAGATGCTTTGACT
TCCCGTGTATCAGTACTCGAGTCCGCTGACGTGAGCTCCGAAATCAAGGCAGATATCCAA
GAAAATGGTTTGTACCTCGGTAACAGATGGTGGATCGGTGAACAGTTCGACTAACTCTTC
GCCATAGATATCATATCGCCCTCATATTATAGATTCAGAAACGATTATAACGCCACTTTA
TGA


>Contig13213.0.g97(protein)
MIVATATVLVTSPANAIRNKLAHSIGERNLVQMSGGGSGGAGSSGDSGNDGSFLSSNDYQ
WSDSALSDWIDKLNSGEQLGNCSCEVTTTPAAETTQVECTTAAPETTAAPETTAAPETTV
APETTAAPETTVAPETTAAPDTTAAPETTAAPETTQAPETTTPEPTPSFPSNETPTPEPT
CTCEEQCSADNTANDMYNPEYDCNWVYNSDMEAWMCIKQNCTWNFDNSTCMWQCIDNVVP
PSNTIPPSSNGTCNYTCEEIQNLFSSNELLQGLVSTLYEEVSSQRDFINQLATDLQSAGT
AIGALLEQQTSMGQAIDALTSRVSVLESADVSSEIKADIQENGLYLGNRWWIGEQFDQLF
AIDIISPSYYRFRNDYNATL