Identifiers and Description

Gene Model Identifier

Contig19712.0.g78

Standard Name

EXO3

Aliases

Contig19712_0_g78

Description

Exonuclease VII small subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19712.0.g78(coding)
ATGAAGCATTTGGTTAAAGAGGGAAGATCAGCTCACACATTTAACTTGAACCTATTGGAA
TAGGTTGATTTAGGTTTAGGAAATCTGTTGCAAAATGAAATTGAAGAGAGCAGTATAGGA
TACTCAGATTAACTGATTTTAATAAATTTAAGTCAAGAAATTGTGTTATGTATAAAACTT
TTCAAGGATAAGTTATCTGATCAACATTATTGCTTGCTAAGCAAGATTATGGTTAAATCT
TCTGATGTCGCAAGGGATATGATTATAAAGCAAAAGAATATAAAGGGACAACTTGACTTA
GAATGCTGTGAGAAATATCTGACCATTTCTTCAACAGCAATAAAATACTTATACAAGCAT
GCAAAAGAGTTTAGTTTTGCTGTGAAATTACTTAACTAATGCCAAGAAACTATACAAGGA
CTTCAGATAATATCCTTTTTAGAAGAGCATCAATAGTCCCAGTAAATAAACTAGCATTTG
TATGAGTTGATTCTAGTATCTTTCAAGCTATACCTAACACCTTAAAATGTTGATAAGAAT
TCTAAAAATCAATTCGACTTGTAACAAAAGTTGTACATGCTCAGTTATGAGGAGATTACA
AATCACTTTAGAGGAGGAATTAAGCTGTTATAAAAGTGCTCCCAGTTGTTGGATTAATCT
AATCTTGCAAAGATTTTGGCTTCATTGATAAAAGTATTTGATGTATTATCAAGAGGATAT
AAACAAATTCATGATTAGTAAAGTCACTAAGCTATTTTTGAAGTGCTTTAAATGTTTTCA
AATTATCTAAAAGACTACTAAATCAAACCTCAATAAAATAATCGTACTCTAAATAAAATA
TCGATAAATGGACTAAATACCAACATGCAATCTTCAATTTTTGTTTAGGCTCTATATAAA
AAGTTTATGATTTTGGCTGCGGATTTGATGATCTAAATGCAATAATATGAAACAGTTCCA
TTTTTCTTAGAAGAAACCTCCTAATTTATTCAAATAGGAGAAAAAGACGAAATCAAAATC
CTCCTTTTGGCTTTTAAGTTAAATTGTCTCTCAAACTAACAAGTCAAAGACTAAACCAAT
TCAGATTAGGAAGATCAAGAATTAATCTCAAGTTTCTTAAAACTATTTTAGCATTAGCAT
TTTTAGAGTGAAATTTCACTTGAGTGTTTCAAGACCTTAGCAATTTGCAATAGAAATGAG
CTCAGTATAACAGTTGGTTTGCATATCCTTAAACTCTGCGATAAATTACTAATTGATATA
AGATCCTAGAAGGAGTTTATTATGCGTTTCTTAATGATATTTGAAAGATACATGGATTCT
AAGAAAATCAAAGACTATATAAATCTTAACAAGAAAACTCCTGGAAATTCTAGAATTTCT
GAAATTCTAGACTGCTTAGTTAATTCTCTTAGTAAATTAATAAGTCTAGAGTTTATTAAG
CAATGTAAACCTTTAGAAGTGAAGAGCTTATTTTATTCTGTCTGGAATGTAGCTTTTGAG
ACACATAAAAGAGGGATGATTAAGGAATGTTAACTTTTACTTCGACAGCTCTACGACTAA
GTAAAGAAATTTACACTTCTCTACAAAGAGTTAAGTGGCCATAATTAACATGACTATAAC
TAGATTCAACCAAAGCTTACAAAACCTAATCAAAAATAATTTGAAAACCATTCTGAGTTA
ACAAAGAATCAATTAGATGAGAAGGTTGTTACAGAAATAATTCTGAAAACTCTCTGGCTT
GTATGTGAAATGAATCTCTAATTGAAAAACTACTAAGATGCCCATAAAGCCATTAAAGAT
ATGGAGTTGATCCAAAGAAATGATGCTAGCACTTATCTTCTAAAAATAAGAGTTCTTTTC
TGCTAAATCGAAGAGACTAATACTCATGAAAGCTAACAATTGAATTTGCAAACTTAAACT
TAGCATGAATAGAAAAATATCTTGGATGAGATTATGGCAACTATGACTCAACTTTAAAGG
ACAGAAGATTTTAACTTTGTTCATATTCTTTCAATTTTAGAAGAAGCAATGAAATCTAAA
ATCTAGAATCTTCTTCATATTATTGCCAAAGATGAAATCAACTAGGCTCATCCTAACTTT
AAAAATAATAAAATGCAGCATAAACCATTTACCTTCAAAAATTTCACATTAGTCAAATTC
CTTGCTTCAATTATAAATGAGAAAAGTATCTAAGAGTTAGGAAACTGTGATTAGAAAGTA
AAAATTGAGAAACTCTAAACCTTGTCTTAAGAATTCATTATGAACCAAAGAATAATAAAG
CCAATGCTTAATTTTATCTAATCAATCATTTATTAGAATGATTAAAACTAAGAACTATCA
TTAGTAGAAAGGAAAGAAAAATTAAGCTTACTTATTGACTATTAGGATGCTTAATGGTTA
TCAAATCTGTTTTGGATTGAATTCAATTCATACATTCAAAATAGAAATACTGAGCTGATG
ACAGATTCAATAGAAAGTCATTAAAAAACTGATTACAAAGATATTTACAAGAATTCTGAA
ATATTAGAATCCCATGTCTTGTTTGCTCAAGTATCAGATCTATTCCTGGAGCTTGAAATG
TGCAAAAATGATTCATTAGATATGAATCAAGCAGCTTAAAGCAATTTTTCGGATTAAGTG
GTTCTAGATTTTATAAAAACTAAAGAGCAAATTGTAAACTCGTTGCTTCTTCTCATTCAA
GTGAAATACTCTGTGCTAATTCTAAACAAGCCTTTGCCACTTAATCATGATATCTTTGAG
ATTTTATCAGAGGTTTAGAATCTATAAAGCTTCATAATGTAAGCTTTAGATACCATGGGA
AGTCATAATGTTTTAAAAGAAATTCTCAACCCTAATTAAAATGTTTAAGCTAAGCTTGAG
GATAAGAAAACACTTTAAGTTCCTTTAAAATAACTCAAGAATAAAAAGATTTAGCCAAAA
CTTCAAAAAGCTAAAGACTTTTTGCTTAGTACACTTTCTTTTATTGAAATTATGGAATTT
AAGCTAAAAGTGAGATAGCATTTCGATGAATCTTAAATTGAAGTTCAGTAAAAGTTGCTG
AAGAAACTTATCGAAACTGTGCTGTTAAAACTCAATGAGTTCAGAGATGAAATCAATTAA
AGCAACGCTTTACAAGAACTCCTATCAGCCCATAAGGATCTTGTAGAAATAACAGAGTCA
CCCTCAGAAAAGCTTTTATTTCTTAATTAAACTTTCAAGCATATCGAGAATGCAAACTTT
GAAGAATGTGTAAATTTAGACTACTTGAAATGGATGATCGGACTTTCGTGGAATTAAGGA
ATCTCGTTGTATAAGAAGTAAGATCAATATGAGGCTATGCAGTGGCTAAATTTTTCAATT
ATGCTTTTGAAAAGATCTGAGGAACAATGTTAATTGAAACTTTCTCAAAATCATACTCTT
CAAAGACCTAATCAAAGTTTCAATGGTATTTCTCGAGATGCAAATGATTTTCAAAATACA
AAGCCTACAACCACCATTATATCTCCTTAGAGAAAAGAAGAATGGCTTGAGTTCGCTAAC
TATTTGAAGCTAATTGCCCCAAAGATGGAAGACTATCATTAGAAAGTTCTATATGAAGTC
TAGTGA


>Contig19712.0.g78(protein)
MKHLVKEGRSAHTFNLNLLEQVDLGLGNLLQNEIEESSIGYSDQLILINLSQEIVLCIKL
FKDKLSDQHYCLLSKIMVKSSDVARDMIIKQKNIKGQLDLECCEKYLTISSTAIKYLYKH
AKEFSFAVKLLNQCQETIQGLQIISFLEEHQQSQQINQHLYELILVSFKLYLTPQNVDKN
SKNQFDLQQKLYMLSYEEITNHFRGGIKLLQKCSQLLDQSNLAKILASLIKVFDVLSRGY
KQIHDQQSHQAIFEVLQMFSNYLKDYQIKPQQNNRTLNKISINGLNTNMQSSIFVQALYK
KFMILAADLMIQMQQYETVPFFLEETSQFIQIGEKDEIKILLLAFKLNCLSNQQVKDQTN
SDQEDQELISSFLKLFQHQHFQSEISLECFKTLAICNRNELSITVGLHILKLCDKLLIDI
RSQKEFIMRFLMIFERYMDSKKIKDYINLNKKTPGNSRISEILDCLVNSLSKLISLEFIK
QCKPLEVKSLFYSVWNVAFETHKRGMIKECQLLLRQLYDQVKKFTLLYKELSGHNQHDYN
QIQPKLTKPNQKQFENHSELTKNQLDEKVVTEIILKTLWLVCEMNLQLKNYQDAHKAIKD
MELIQRNDASTYLLKIRVLFCQIEETNTHESQQLNLQTQTQHEQKNILDEIMATMTQLQR
TEDFNFVHILSILEEAMKSKIQNLLHIIAKDEINQAHPNFKNNKMQHKPFTFKNFTLVKF
LASIINEKSIQELGNCDQKVKIEKLQTLSQEFIMNQRIIKPMLNFIQSIIYQNDQNQELS
LVERKEKLSLLIDYQDAQWLSNLFWIEFNSYIQNRNTELMTDSIESHQKTDYKDIYKNSE
ILESHVLFAQVSDLFLELEMCKNDSLDMNQAAQSNFSDQVVLDFIKTKEQIVNSLLLLIQ
VKYSVLILNKPLPLNHDIFEILSEVQNLQSFIMQALDTMGSHNVLKEILNPNQNVQAKLE
DKKTLQVPLKQLKNKKIQPKLQKAKDFLLSTLSFIEIMEFKLKVRQHFDESQIEVQQKLL
KKLIETVLLKLNEFRDEINQSNALQELLSAHKDLVEITESPSEKLLFLNQTFKHIENANF
EECVNLDYLKWMIGLSWNQGISLYKKQDQYEAMQWLNFSIMLLKRSEEQCQLKLSQNHTL
QRPNQSFNGISRDANDFQNTKPTTTIISPQRKEEWLEFANYLKLIAPKMEDYHQKVLYEV
Q