Identifiers and Description

Gene Model Identifier

Contig18799.0.g41

Standard Name

EXO1e

Aliases

Contig18799_0_g41

Description

XPG I-region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR033C1.99927841627239e-68EXO1 SGDID:S000005559, Chr XV
from 394524-392416, Genom...
T. thermophilaTTHERM_011799607.998077742349047e-67XPG I-region family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18799.0.g41(coding)
ATGGGAATTTAGAACTTACTAAAGCATCTATCAGAAATAGAGAAAAAGAAGCATATCAGA
GACTATGCGGGTTTGAGGGTGGCAGTGGATGGATACTGCTGGTTGCACAAGGCAGTCTAT
ACATGCAAGGAATAAATGGCATAGGGGTAAGGACTGGATAAACTTATTCAGTACTGTACA
AAGAGAATAAACATGTTAAAAAATCATAACGTAACACCTGTTATGGTTTTCGATGGAGGT
AAGCTCAACATGAAGAAGAGTACAGAGGAGGTTAGACAAAAAACGAGAGAAAAGAATTAC
AAGAAGTTTCAAGAGTACATGAAAAAAGGAAACATGGATAAGGCTATCAAGAAATATGGA
GAGAGCATAGATATCACACCTTAAATGGCCCATGTTTTAATTTAAGTCCTTAAAGCCTAG
GAGGTCGAATATATTGTAGCTCCATATGAGGCTGATGCATAACTCGCATTCTTATGGCAT
AAAGGTCATGTTTAAGTTGTGTTCACTGAAGATTCAGATTTGCTTGCGTTTGGAGTCAAG
AAAGTATTTTTCAAAATGGACTCTGATGGTTTCGGTATTGAAATCGATCTTGATAAACTA
CAGACTATTAAAAAGCCAGACTTCACAATGTTCACTTAGGATATGCTCTTGACTACTTGT
ATCCTTTCCGGGTGTGATTATTTAGACTCTATCAAGGGTATAGGATTTATGAAAGCTCAA
AAATTAGTCCAAGAAAGCGGGCCTGTAGATACTTTTCATGATGTCCTTGGATATTTGAAA
GATGAGGGCAAGTCAGTCATACCAGATGACTACGAAGAAGACTATAAGAAAGCATTTTTG
ACTTTCAAATTCTAAAGGGTATTTTGCCCTGTTAGACAGAAACTTGTCATGCTGCATGAC
ATAGCAGAATGTGAGCATGGTTCAGAAATTGCTAAAATCAAAGATACAAGTTTCCTAGGA
AATGATATTGATGATTACAGAACTTAAAGAATTGCAAGAGGAGAAATTGATCCTATTACT
TATTAAGAATTTGTAAGAACACAAGCTGAAGACGAAATTATTGGAAGACTTGGCAAAATC
AGAACAAGGAAAACCCTTAATCTATCAAGCTAAAACACTGAGATTAAGTCGCCTAACTAA
GCAGACCTTCCGAAATTTCTAGCTAACAATCCTCATCCTGACTATCTCAAACTTTGGAGT
AGAAGCCCTCAATGCTTTTGGAAAAAGTATCACGAAGACAAGAAAAATGGCTGTTTAAAG
TATGTCAGCCGTGGCTTCGGAAAGAAAAGAAAAGCTCCAGATACCATGAGACAAGATACC
ATAAGTTTCAATAAGAAGCCAGTAGATTCAGAAGATGATGATTTAGGTGGCTTGTCTCCA
AAGGCTTGCAGAGAAGCCAAGTAATAAACAATTGATGATGAGGAACAGCAATTTTTGCAC
GATATGAACATTTCAGATAGACAGAGAGATGATGCTCTAAATGGATTTCTAAATAGAACA
TAGTATAATGGCAAAAAGGGGAAACTAAGCGAATAAGATATTAAAACTGCAAAAGCTCTA
AAAGAATTCAGAGATGAGGAAATGAAAAAATAGAAAAAGAAGAGAGAAGAGAAGTTAAAA
TAATTCAAGAAGCGCCGAGAAGATAAAAGAGATAAGCAAGACAAAAAAAAGTAGTTTCTT
TAAGTTATGGAAAATAATGCGTTGATAGCTTCAGGTAAGGCAAGTGTAGCTGCTATGTCT
TAATTAACTCCAAATTTGACTTAAAACTTGCTTATGAGTTAACTTCAAGGGTAATTCTAG
ACATAAATTTAGAAGCTAGCTGAAGATGAAGAAAGCAGTAGTACAAGTGAAGATGAAAAG
GAGAAGCCATTCAAGCTCTTCAATAAGGATAAAGCTATTACAAAATCAAAAAAATCTAAG
AAAAGTAAAAAGTCTAAAAAAGATAAGAAAGTAAAAAAAGATAAGAAAAAGAAGAGAGAT
TCAAAACAGGACAATAAGAAAATGAAAACGCTTTCTGATATTGGGGGAAATAGCACAGAA
AAAGAGATGATGGAATGCTTTGAATAATTCACTTAGTAAAATTCATCTCCTGGATTTTAA
GTTATAGCACCTTCATGCAAAAATTTAACTAAAACTAGCGTCAGCGCAGCTCAAAACACT
CAAAACTCAACTTGCATCCCATAACTGTTAACTTAATAATCAGTTCCCTTGACACCAGCT
CTATAAACTCAAATTCTTTAAGATTAATTTGGATTTATGAATACATAAGCTTAAAATACT
CAATTAAGAGAAAATGGTCCAAGTGAAGATTTTGAAAAGATGTTTATGTAGATATGTGAA
CCTGAAAAATTTAAGAAAAAATATGGAGGAAAAGCGAAACTCATGCCACCATCTTACATT
TGCAAAGCAACAAGACAGGGTGGTAAGAAAGGGAAAAAAGGGTCAAATTTTGCTCCAATA
GATTTAGATAAAAGTTTCGATTCTTCGGTAACTAGTCCAATAAGTGTTGGGGGAATTGAT
AGCTTGCTTTAATCTTAACTTTCAACAAATCTACCATAGGCTAGTAACCAAATAAACAGT
GGTAAATCATAAAGCTCAAGCAAATCCTCTACTGAGAAATCATACTTTGAATAGTTCAAT
AATCCAGGTAAAACGATCAGCCAATTGGCTTATTCTGTAGAACCTTAACATAGCTAATTA
TAAGCTAAATCATCAAAAGAAGTAAAATAATCAAAATCAAGCAAGAGAAATAAGAAGTTA
CCACATGACCCATTTGCAGAGGATTAAAGCACAGTTCAAACGAAAAACTTATCATTTGCA
AATATTCTGAGTAAGCCAAGTTAAAACAATCATTCAAAAGATTCTGGGAGTCAAAATTAA
AATTCTAAAAATCTATCAACACAATCTAGTTCAGGTATTTTGAATTAAAATATAGATAAT
TCACAACCTGTACCTGCCAATCCCTTATTGAGACAATTAGCCTATGAGAGATAACAAAGA
AATATTTAAAAGTCAAAAGCTTGA


>Contig18799.0.g41(protein)
MGIQNLLKHLSEIEKKKHIRDYAGLRVAVDGYCWLHKAVYTCKEQMAQGQGLDKLIQYCT
KRINMLKNHNVTPVMVFDGGKLNMKKSTEEVRQKTREKNYKKFQEYMKKGNMDKAIKKYG
ESIDITPQMAHVLIQVLKAQEVEYIVAPYEADAQLAFLWHKGHVQVVFTEDSDLLAFGVK
KVFFKMDSDGFGIEIDLDKLQTIKKPDFTMFTQDMLLTTCILSGCDYLDSIKGIGFMKAQ
KLVQESGPVDTFHDVLGYLKDEGKSVIPDDYEEDYKKAFLTFKFQRVFCPVRQKLVMLHD
IAECEHGSEIAKIKDTSFLGNDIDDYRTQRIARGEIDPITYQEFVRTQAEDEIIGRLGKI
RTRKTLNLSSQNTEIKSPNQADLPKFLANNPHPDYLKLWSRSPQCFWKKYHEDKKNGCLK
YVSRGFGKKRKAPDTMRQDTISFNKKPVDSEDDDLGGLSPKACREAKQQTIDDEEQQFLH
DMNISDRQRDDALNGFLNRTQYNGKKGKLSEQDIKTAKALKEFRDEEMKKQKKKREEKLK
QFKKRREDKRDKQDKKKQFLQVMENNALIASGKASVAAMSQLTPNLTQNLLMSQLQGQFQ
TQIQKLAEDEESSSTSEDEKEKPFKLFNKDKAITKSKKSKKSKKSKKDKKVKKDKKKKRD
SKQDNKKMKTLSDIGGNSTEKEMMECFEQFTQQNSSPGFQVIAPSCKNLTKTSVSAAQNT
QNSTCIPQLLTQQSVPLTPALQTQILQDQFGFMNTQAQNTQLRENGPSEDFEKMFMQICE
PEKFKKKYGGKAKLMPPSYICKATRQGGKKGKKGSNFAPIDLDKSFDSSVTSPISVGGID
SLLQSQLSTNLPQASNQINSGKSQSSSKSSTEKSYFEQFNNPGKTISQLAYSVEPQHSQL
QAKSSKEVKQSKSSKRNKKLPHDPFAEDQSTVQTKNLSFANILSKPSQNNHSKDSGSQNQ
NSKNLSTQSSSGILNQNIDNSQPVPANPLLRQLAYERQQRNIQKSKA