Identifiers and Description

Gene Model Identifier

Contig21369.0.g33

Standard Name

EXO1a

Aliases

Contig21369_0_g33

Description

XPG I-region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007735204.001670058321624e-73XPG I-region family protein
SGDYOR033C7.00174216458014e-43EXO1 SGDID:S000005559, Chr XV
from 394524-392416, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21369.0.g33(coding)
ATGGGAGTCTAAGGATTGTTACAATTGCTGAAACCAGCACTTAGAGATTGCCATTTATCG
CAATTCAGAGGACAGACTGCCTCAGTAGACATTATGACATGGCTGTATAAGGGAGCTTAT
GCGTACTCTTATGAACTGGGGTTGGATTCGTAGACGCTTGGATTTTTGGCATATCCTCTG
AAAATGTTGAAGTTGGTTCAGACTTATGGAATAAAACCAATCTGTGTATTTGATGGGTAG
CACTTAAAAGCCAAAGAAGCCACTGAAAAAGTTAGAAGTCACAACAAACAAGTAAACAAA
GAATTGGCCATGCAAAAGGCTGAGGATGGAAATGAAGAAGATGCTAGGAAATATTTCATG
CGCAGTCTCATCCTAAGAAGCAAAATGATTGATTTGTTCATCGATATCCTTAAGAAACTA
GAAATTGAGATGGTAGTCGCGCCATATGAAGCAGATTCACAAATTGCATACATGGTGAAG
GAAGGCATTGCAGATTTTGCTATCAGTGAAGATTCAGATTTAATTGCTTATGGGTGCCCT
AAACTACTTATGAAACTTAATTTCAATGGGTATTGCAAGGTATTCTCTATTAATGATTTC
AAGGCCAATAACCAAATTACTGATCAGACTTTGGCTTATCTTCAGAAAACAAGCAGAGAA
TAATTCGTGCAAATTTGTATAATGGCAGGTTGTGAGTACCTTCCTAGTATCTAACAAGTA
GGCCTCAAAGTTGCTATCAAGTTGTTTATGAAGAATAATGGTGATGTTGAATAGGTCTTG
GAGAGCTTAAAAACGAATAAAATCTTCAAGGATAGAGTACCAGAGGGATATTTATCAGCT
TTGAAAAAAGTGTAGCAACTGTTTTTTTACTAAACAGTTTTTGACACCAGAATTGGTAAA
TTGACCTCTCTTGAAAAATTTGAACCCAAGCCAGCTATTGCATAATCACCTGTGAAATAA
AACGAGTCTTTAGAAGAATTAAAATAAGAAGAAACTCAAATCTCCACAACTACCACTTCA
AATAAAAAGTAAAAACAATCTGCAGCTAAGAAATCAACCTCTAAATCCCCAGCTAAACCT
GTTTCCACTTCAGTATCATCAAATTAAAATTCTGATAGTGTGAACTTCAACCCAGATGAG
TTGGATTTAGAATATATGGGCTAGTACATTCCAGAGCATCTACTGTAAGATTTCGCATCT
GGCAGACTAAAAAAGTCTTCTATGACTCTCAGAGACAACTACATAAATGTGATTGACTTC
AAGAAGATATTTTTGGATTACATCGACAATCAGATTAGCGAGAGAAGTTTCATTTGCGTT
GATAAGAAATTTTTCAATAGTGATTTCTAGTAAAGCGACAGATTGCATGGCTAGTAGATT
CACAATCAAGATAATGGACAAGAAGAAGAAAAAAAGTAGAGCAATAATAGATAGTAAGAA
GTTCACTAACCAGCCGGTTTGATCACTGAGAGGAAGAAGTTAGTGGAGGATGATCTTGGA
TTTTGTATGGACGAGGACTCCAGTGATAACGAAGATAATTTCCTCTACGCCTCTGAAAAA
GAAAATGAGCACTCATAGATAGCAGAGATAAAAGCCAAGCAGATCAATATGGACAACAAG
TTCCTTTAAAACGATTTCGCTTATATGTCTACAGCTCACGCTGAAATCTAGGAGAGAGTC
AGATTAAGTCAAGAATATAAGAATAACTTCTAGAGCAATAACAGTGGAATGAGTACTCCC
TAGAACAACAAATTCAGTGCAATGAATGTATTTGCCAAAAACTCAAACATTCAAATGTCG
TCCCAGAACTCTCTTGAAACCAATCAAATCTAATCATTATCATAAAACAAGGAAATCATC
ACATCTAGTGCAAAGGGTTTTAAGAAATTTGATTAGGTTTTACCTGTGCTTCTTGAAGAG
GAAGAGAAAAAAGATAAAACAAAGAGTGACAAGAAGGTAAATACTGGAAAAATCTCTGAT
TATTCAGCTGCCAAGAATTAAAGTTCCCCATCAAAGGTAAAGTAGGAATCAGCTAAAAAT
GTCAAATAAGCAAATAAAAAGAGAAAACTAGATGAAATTAGTAAAACTGAAGCCAAAAAA
GTCGCTGTAAAGAGTGAAAAGCCAAATGGAAAATTGGACAGCTTCTTTGGAAGTAAGCAG
AATAATTAATAAACTAACTCTAAAAGAATGAAGAAAAATACTTGA


>Contig21369.0.g33(protein)
MGVQGLLQLLKPALRDCHLSQFRGQTASVDIMTWLYKGAYAYSYELGLDSQTLGFLAYPL
KMLKLVQTYGIKPICVFDGQHLKAKEATEKVRSHNKQVNKELAMQKAEDGNEEDARKYFM
RSLILRSKMIDLFIDILKKLEIEMVVAPYEADSQIAYMVKEGIADFAISEDSDLIAYGCP
KLLMKLNFNGYCKVFSINDFKANNQITDQTLAYLQKTSREQFVQICIMAGCEYLPSIQQV
GLKVAIKLFMKNNGDVEQVLESLKTNKIFKDRVPEGYLSALKKVQQLFFYQTVFDTRIGK
LTSLEKFEPKPAIAQSPVKQNESLEELKQEETQISTTTTSNKKQKQSAAKKSTSKSPAKP
VSTSVSSNQNSDSVNFNPDELDLEYMGQYIPEHLLQDFASGRLKKSSMTLRDNYINVIDF
KKIFLDYIDNQISERSFICVDKKFFNSDFQQSDRLHGQQIHNQDNGQEEEKKQSNNRQQE
VHQPAGLITERKKLVEDDLGFCMDEDSSDNEDNFLYASEKENEHSQIAEIKAKQINMDNK
FLQNDFAYMSTAHAEIQERVRLSQEYKNNFQSNNSGMSTPQNNKFSAMNVFAKNSNIQMS
SQNSLETNQIQSLSQNKEIITSSAKGFKKFDQVLPVLLEEEEKKDKTKSDKKVNTGKISD
YSAAKNQSSPSKVKQESAKNVKQANKKRKLDEISKTEAKKVAVKSEKPNGKLDSFFGSKQ
NNQQTNSKRMKKNT