Identifiers and Description

Gene Model Identifier

Contig21968.0.g12

Standard Name

ETF1

Aliases

Contig21968_0_g12

Description

eRF1 domain 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR143C3.0010924337054016e-176SUP45 SGDID:S000000347, Chr II
from 532182-530869, Geno...
T. thermophilaTTHERM_002921706.999124466619517e-162eukaryotic peptide chain relea
se factor subun...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21968.0.g12(coding)
ATGGTTGAATCAATTGCTGCAGGTCAAGTTAGTGATAACAAGCACATCGAGATGTGGAAG
GTCAAGAAATTGATCAGTAAATTAGAGCATTGCAAAGGTAACGGTACCAGTATGGTCTCC
TTGATCATTCCTCCAAAGGACGATATCAACAAGTATGGTAAATTGCTTACCGGAGAAATG
AGCGCTGCTTAAAATATTAAGAGCAGAATTACCAAGCAATCAGTCGTGACTGCTATCACT
TCAACCAAAGAAAAGCTGAAGCTTTACAAGTAAACACCCACTAATGGTCTTTGCTTATAT
TGTGGTGTTATTTATATGGAAGATGGAAAGACCGAGAAGAAAATTAACTTTGATTTTGAG
CCATTCCGCCCAATCAACTAGTTCTTATATTTTTGCGGTGGTAAATTCCAGACTGAACCA
CTTCTTTCCTTATTGGCTGATGATGACAAGTTCGGTTTCATTATTGTCGATGGTAATGGT
GCCCTCTATGCCACTCTCCAAGGAAACAGCAGAGAAATTCTTTAAAAGATCACTGTGGAG
CTCCCTAAAAAGCACAGAAAGGGAGGTCAGTCTTCAGTCAGATTTGCTCGTCTCAGAGAA
GAAAAGAGACACAACTATTTGAGAAAGGTTGCCGAACTCGCAAATCAGAACTTCATCACC
AATGATAGACCAAATGTTACAGGTATCGTACTTGCAGGTAATGCAGCATTCAAGAACGAA
TTAGCTGAGACTGATATGCTCGATAAGAGACTTCTTCCAGTTATTTGCGCAGTTGTGGAT
GTTTCATATGGTGGAGAAAATGGACTTAATGAGGCTATCACTCTAGCAGCTGAGGCTTTG
ACCAACGTCAAGTTCGTTGCTGAGAAGAAACTTGTCAGCAAGTTCTTTGAAGAAATTGCT
CTCGATACTGGTATGATTGTGTTCGGAGTAGACGATACTATGAAAGCCTTAGAGTTAGGA
GCAGTGGAAACTGTTCTCTTATTCGAAGAACTTGATATTAATAGATATGTTCTTAAGAAC
CCAGTTAAAGGAGACACCAAGACTATCTACTTGAATAGCACCTAACAAAAGGATTCAAAG
TACTTCAAGGATAGAGAGACAGGCATGGATTTGGACGTTGTTTCAGAAGATTCCCTTGCT
GAATGGCTTTGCCACAACTACTAGAACTATGGTGCTCAAGTTGAATTCATTACTGACAAG
TCCCAAGAAGGTTTCCAATTCGTCAAGGGATTCGGTGGTATTGGAGGTTTCCTTAGATAC
AAGGTTGACATTGAGGACCATCATGGAGATCTCGGAGCCGGTGGTGACGATTTCGACCCA
GACACTGATTTCATCTGA


>Contig21968.0.g12(protein)
MVESIAAGQVSDNKHIEMWKVKKLISKLEHCKGNGTSMVSLIIPPKDDINKYGKLLTGEM
SAAQNIKSRITKQSVVTAITSTKEKLKLYKQTPTNGLCLYCGVIYMEDGKTEKKINFDFE
PFRPINQFLYFCGGKFQTEPLLSLLADDDKFGFIIVDGNGALYATLQGNSREILQKITVE
LPKKHRKGGQSSVRFARLREEKRHNYLRKVAELANQNFITNDRPNVTGIVLAGNAAFKNE
LAETDMLDKRLLPVICAVVDVSYGGENGLNEAITLAAEALTNVKFVAEKKLVSKFFEEIA
LDTGMIVFGVDDTMKALELGAVETVLLFEELDINRYVLKNPVKGDTKTIYLNSTQQKDSK
YFKDRETGMDLDVVSEDSLAEWLCHNYQNYGAQVEFITDKSQEGFQFVKGFGGIGGFLRY
KVDIEDHHGDLGAGGDDFDPDTDFI