Identifiers and Description

Gene Model Identifier

Contig10960.0.0.g43

Standard Name

ESF1

Aliases

Contig10960_0_0_g43

Description

NUC153 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR365C1.0004783691736523e-35ESF1 SGDID:S000002773, Chr IV
from 1206383-1204497, Gen...
T. thermophilaTTHERM_000491201.9991517704232713e-32hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10960.0.0.g43(coding)
ATGAGCGTTCCTAAAAAGCTGAAGAACGTAGAGATTGACGATAGGTTCAAGAAAGGTCTG
GCCAGTAAAGAGTTCAATACTGTCACTAAAGTTGATAAATACGGTAATCGCAATCAAAAG
GTAGATAACTCAATGATGAAATTCTACAATATCGACAAAAAAGACAGCAAATAAAAGTAA
GATAGTGATGATGAAGGCAGTGAGGAAGTAGATAATAAGTTCTATGATGAAGAGGGTAAA
TTCAAGTGGGAAGCACAAAGCAGCAGTGATGAAGAAAACGAAGAGGATGTTGAAGCAAGT
GAACAGGAAAAAGACTCTGATGATGAAAGTGATGAAGAGGATATTAATGAGTAGGATGTT
GGTCTCTAGTCTGGTGAGGAGGATGACTCTGTGTGGTCTGTGTAGAATGAAGGGGAAGAA
GTTGATGAGCAAGAAGTACAGATTGGCAAGAGATTGGCCTTAACTAACATGGACTGGGAT
GCAATGACTGCAGTAGATTTATTTGCATTGTTTTCGTCTTTATGCAAGGGAGATATGTTC
ATTTCTAAAGTTGCCATTTATCCAAGTCTCTTTGGCTTAGAACAAATGAAGAAAGATTCT
TTATATGGACCACCAAAGGAAATAATGGATGTAGAGCCTGCGAAAGGAAAGAAAAAGAGT
AAAATAGCTGAGGGAAATGAAGATGAATTTATGGATGATGATGAAAAGCTAGCATTGGGA
TATAACAGTTCACAATTAAGGAAATATGAAATACAAAAAATGAAGTATTACTACGCTGTT
GTCCACTGCTCCTCGAAGAAGACAGCGAAATAGATATACGATGAATACAACAACTTCGAG
TTTGAGTTGTCCAATATCCGTCTTTCCCTCTCCTTCATCGCCGACGATTTGAAATTCCCT
CAGGCCCCCAAGGAAGTCGCAACTGAAATTCCTGCTGGTTATCAATTCCGTACTGCAAAC
ACCATGAGTAAGGCCCTCAATCACACTAATGTGAAATTCACCTGGGATTAAACTGACCCC
AAGAGACTCCAGAAATTCTAGAAATTAATGGAAAAGGACGAAAGCGATGTGGATGAGGAG
GATTACAGAGAATTCTTGGCCAGTGCCTCAGAGGATGAAGCCGATTACGAGAACGAAGAC
CAAGATCAAGAAAAGATAGAGGAATATAGAAAGAAACTACTGGGTGCACTATCCACTGCC
ACTGGAGATATATCTGAGGTGTATAGAACAAAAGACTTGCAAGGTGATGGAGGTGATGAG
TCTAATAAGAAAGAATTAGATATCAGGTTCAATGTGGGTTTCGGAGAAGATGTTGGAAAG
AAACTATTAAAAGAGAAGAAAGAAAAGAAGGATTTGAAGGGAGAAAGCGACTGGACCAAG
TATCAACGCAAGAGAAAAGAGATAAGAAAGGAGAAGAAAGAAAATGCCAAATAGAAGAAG
AAGCAAGGCTAAGTTGAAATTTTCGAGGATGAGAACGATGAACAGGCATTACGCAGGAAA
GCTCAACTAGAAATGTTGGTTGGAAAGAAAAACAACGGCCTCTCAGTTGACTTCAAACCA
GACACCAAGGACAAGAGATTCGAGGCAGTACTTAAAAACAAGGAATTCGCTCTCGATCCC
ACTAACAAGAATTTCAGGAAAGTAGCCGATGGAGAATTCATGAAGGAACAGAAGATCAAG
AGAAGAAAGATGCATGATGATGAGTGA


>Contig10960.0.0.g43(protein)
MSVPKKLKNVEIDDRFKKGLASKEFNTVTKVDKYGNRNQKVDNSMMKFYNIDKKDSKQKQ
DSDDEGSEEVDNKFYDEEGKFKWEAQSSSDEENEEDVEASEQEKDSDDESDEEDINEQDV
GLQSGEEDDSVWSVQNEGEEVDEQEVQIGKRLALTNMDWDAMTAVDLFALFSSLCKGDMF
ISKVAIYPSLFGLEQMKKDSLYGPPKEIMDVEPAKGKKKSKIAEGNEDEFMDDDEKLALG
YNSSQLRKYEIQKMKYYYAVVHCSSKKTAKQIYDEYNNFEFELSNIRLSLSFIADDLKFP
QAPKEVATEIPAGYQFRTANTMSKALNHTNVKFTWDQTDPKRLQKFQKLMEKDESDVDEE
DYREFLASASEDEADYENEDQDQEKIEEYRKKLLGALSTATGDISEVYRTKDLQGDGGDE
SNKKELDIRFNVGFGEDVGKKLLKEKKEKKDLKGESDWTKYQRKRKEIRKEKKENAKQKK
KQGQVEIFEDENDEQALRRKAQLEMLVGKKNNGLSVDFKPDTKDKRFEAVLKNKEFALDP
TNKNFRKVADGEFMKEQKIKRRKMHDDE