Identifiers and Description

Gene Model Identifier

Contig3963.0.g42

Standard Name

ERI1

Aliases

Contig3963_0_g42

Description

RNA 2'-phosphotransferase, Tpt1 / KptA family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring phosphorus-containing groups (IEA) | GO:0016772

Biological Process

  • tRNA splicing, via endonucleolytic cleavage and ligation (IEA) | GO:0006388

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005854503.999244945363787e-60exonuclease family protein
SGDYOL102C9.995528898049344e-31TPT1 SGDID:S000005462, Chr XV
from 126689-125997, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3963.0.g42(coding)
ATGGAAAGAGGTGGAGCATACAGAGGAGGCCGTGGAGGCAGAGGTGGCCATAGAGGCGGC
AGAGAAGTCACCGTCTCAAAGTCTATGAGTTGGATCTTGAGGCATGGTGCTGTCGAATTA
GGTTTGGAGATGGGCAATGACGGCTATGTGTCTGTCACAGATATGCTATAAACACAAAGA
ATGAAGTAACTAAAAGTAACTCTTCAGGATTTGATGGCAGTTGTAGAGAGCAATGACAAG
AAGCGATTTTAAATGAAATCAGAATCAGACCCAATTACTTAAGAGCAAGTTTTTTATATC
AGAGCTGTCCAAGGCCATACTATTAAGACTATTAATGACGAGGAGTTATTGGAAGAAATA
AAGGATCCATTTATCTATGAGGAAGTTATTCATGGTACCTATTTAAACTGCATATAAGCA
ATTCTAAAAACTGGCTTGAATAAAATGGCTAGAAATCATATTCATATGGCACTTGGAATG
CCAGGAAAGAAGGGAGTTGTAAGTGGCATGAGAGGCAGTTGTGAAGTCTTGGTTGAAGTC
AATATGCCAAGAGCGATTCTACAAGGGAAAGTACCATTCTATATCTCACAAAATAGAGTC
ATTCTCTCACCAGGACTCAACGGAGAGCTACCTAGTGCTTATTTCAGATCAGTTATTGAC
ATGAAGAAGAAGGAGTTCTTGTATCAAGCTCCATTTGACTATATTTGTGTGTATGACTTC
GAATGTCAATGCGAAGAGGGCACAAAGAACCTGACTTTCAATGAAATCATTGAATTCCCA
GTTGTAATAATTGATGTAAAAGCCTAAAAAGTAGTGGCTGAGTTCTAAACCTATGTGAAA
CCTACCCTTCACCCTGAACTTACAGAATTTTGCACTAAACTCACTGGAATTGAGCAGAAA
CAGGTTGATGAGGGAGTCACTATCAAGGAAGCTATTTAGCTAGTTCATGAGTTTCTGGGC
AAAAATGGGGTTCTTGAATCAGAGTTTGTGTTTTTGTCATGTGGTGATTTCGATGGAAAT
TAAATGCGTAGAGAAGCTCTTCATAAAGGTTTTGATGTGCCAAACTACTTGAAACGTTGG
ATTAACATCAAGAAAGTCTTCCCAAAACACTTGTTTGACGAAAAAGCAGCCAAGAATGAA
GTGATATTCGTTAAAGATGTCAAGAAATCTGCAGTCTCTGGAATGCCACACATGCTTGAG
TTATGTGGTCTAGAGCTAGAAGGTAGACACCATTCAGGCATTGATGATTGCAAAAATATA
GCCAGATGCGCAATTAAATGCTTATAAGAGGGCTTCTAATTCACTCAAGGCATGGTGCTT
TCACATCCATTTTCCATTGATGAATAACCACAGAGTGATCCTAATGAAGAATCCAAGGAA
TGA


>Contig3963.0.g42(protein)
MERGGAYRGGRGGRGGHRGGREVTVSKSMSWILRHGAVELGLEMGNDGYVSVTDMLQTQR
MKQLKVTLQDLMAVVESNDKKRFQMKSESDPITQEQVFYIRAVQGHTIKTINDEELLEEI
KDPFIYEEVIHGTYLNCIQAILKTGLNKMARNHIHMALGMPGKKGVVSGMRGSCEVLVEV
NMPRAILQGKVPFYISQNRVILSPGLNGELPSAYFRSVIDMKKKEFLYQAPFDYICVYDF
ECQCEEGTKNLTFNEIIEFPVVIIDVKAQKVVAEFQTYVKPTLHPELTEFCTKLTGIEQK
QVDEGVTIKEAIQLVHEFLGKNGVLESEFVFLSCGDFDGNQMRREALHKGFDVPNYLKRW
INIKKVFPKHLFDEKAAKNEVIFVKDVKKSAVSGMPHMLELCGLELEGRHHSGIDDCKNI
ARCAIKCLQEGFQFTQGMVLSHPFSIDEQPQSDPNEESKE