Identifiers and Description

Gene Model Identifier

Contig10186.0.g35

Standard Name

ERCC3b

Aliases

Contig10186_0_g35

Description

Type III restriction enzyme, res subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04851 ) Type III restriction enzyme, res subunit
  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam07101 ) Protein of unknown function (DUF1363)
  • ( pfam08343 ) Ribonucleotide reductase N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIL143C9.997093137033517e-262SSL2 SGDID:S000001405, Chr IX
from 83041-80510, Genome ...
T. thermophilaTTHERM_005296204.000049796805715e-127DNA repair helicase rad25 fami
ly protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10186.0.g35(coding)
ATGGGAGTGAATTCATATTCAACATCCTCACAATTAAACAGGGCTTCAACTGCAACAGGT
ACTACTGGAGGGCAACAAATATTGACTTAAAATATTGAGTAACAGGATTTGACAGAACGA
TTTATGAATCTTAAAGATGAGTTCTAAATTTTCATTGATTAAGAAATGGAAGATGTAGAT
ACTAATGAAGGAGGGTAGGATGGCAGCAGTGTTGATGCGAAGGCTTTACAGAAAAGAAGG
GAAGAATTAATTCTTGAGATTGATGCTGAAAAGATTGAGGAAGTTAAGGAGGCATGTATT
AGGCTTAACTATCCTCTCATTGAAGAATATGACTTTAAACGAGATTAAACTATTCCAGAC
TTAAAAATAGAACTTAAATCTACCACCTAGATTAGAAGCTATTAAGAATAAAGTCTGAGT
AAGATGTTCAGTAATGGAAGAGCAAGATCCGGAGTTATTGTACTTCCTTGTGGTGCTGGC
AAGACCTTGGCAGGAATTATTGCAGCTTGTACTGCAAAAAAGAGTACTATGATTCTTTGT
ACCAGTGATGTGTCAGTCCAGTAATGGAGACAATAGTTTTACCAATGGTCAAATATAGCA
GGAAAGGTTTGCAGATTCACTTCTAGAACAAAGGATCCAATGTTTGAATCTAAAGGTCCA
GACTCAGAAGCTGGTATTGTTATTTCATCTTACAACATGATTGCGTATCAAGGTAGTAGA
TCTGGTTAAACTCAAAAGATAATGGATACTATAAGAAATACAGACTGGGGCCTCCTGATT
TTGGATGAAGTCTAAGTTGTTCCAGCTGAAATGTTTAGAAAAGTTTTAGCTATTTGTAAA
TCTCACTGCAAACTTGGATTAACTGCTACTCTAGTACGTGAAGATAATAAAATTTAAGAT
CTTAACTTCTTGATCGGGCCTAAACTTTATGAAGCTAACTGGCTAGATCTGCAAGAATAA
GGCTTTCTCGCTAGAGTCTAATGCATTGAAGTTTGGTGTGAGATGACAACAGAGTTCTAT
AGAGAATATTTAAATCATAATCTTAAGCCAAGAATGAAGCAGGTATTGTACGTAAACAAC
CCAAACAAATTCCTGGCATGTTAGTATCTAATCAATCTTCACGAAAGCAGGGGCGATAAA
ATTATTGTATTCTCAGACAACTTATTTGCTCTCAAAATGTATGCTAAGAAATTGAAGAAA
CCATACATCTCAGGTGATGTTAGTTAATCAGAAAGAATGGGAATTTTACATTATTTCCAA
AAGACTAATGAAATCAATACTATTTTCCTGTCAAAAGTAGGAGATACTTCAATCGATCTC
CCAGGTGCAAATGTGATTATTCAAATATCTTCCCATTTCGCTTCTCGTCGTTAAGAAGCT
TAGCGTCTCGGCAGAATTCTCAGACCAAAGCAAAGCGCAGAGAAGCAAGCTTACTCTAAC
TCCGAAGAATTCAATGCCTATTTCTATTCTCTAGTCAGCACAAACACCTAAGAAATGTAC
TATGCAGATAAGAGACAGCAGTTTCTGATTGATTAAGGTTATTACTTTGAAGTCATATAG
GAATTGCCCTTCCAAAAAGACCCCTTGCAATTGTAAAAATTGCAGATGACTACAATCAGA
GAGCAAGTTGACTTCTTAACTTCCATTCTACAAAACGATGAGACTAAGTTTGAAAGGGAA
GAAGAGCAGGAAGATAGAATTGAGGAGGATGAAGATTAACTTGAATTGGAAAGATGGAGA
CGCAGAGAAAGAAATATTGGAGCTTTGACAGGGGCTGATTGA


>Contig10186.0.g35(protein)
MGVNSYSTSSQLNRASTATGTTGGQQILTQNIEQQDLTERFMNLKDEFQIFIDQEMEDVD
TNEGGQDGSSVDAKALQKRREELILEIDAEKIEEVKEACIRLNYPLIEEYDFKRDQTIPD
LKIELKSTTQIRSYQEQSLSKMFSNGRARSGVIVLPCGAGKTLAGIIAACTAKKSTMILC
TSDVSVQQWRQQFYQWSNIAGKVCRFTSRTKDPMFESKGPDSEAGIVISSYNMIAYQGSR
SGQTQKIMDTIRNTDWGLLILDEVQVVPAEMFRKVLAICKSHCKLGLTATLVREDNKIQD
LNFLIGPKLYEANWLDLQEQGFLARVQCIEVWCEMTTEFYREYLNHNLKPRMKQVLYVNN
PNKFLACQYLINLHESRGDKIIVFSDNLFALKMYAKKLKKPYISGDVSQSERMGILHYFQ
KTNEINTIFLSKVGDTSIDLPGANVIIQISSHFASRRQEAQRLGRILRPKQSAEKQAYSN
SEEFNAYFYSLVSTNTQEMYYADKRQQFLIDQGYYFEVIQELPFQKDPLQLQKLQMTTIR
EQVDFLTSILQNDETKFEREEEQEDRIEEDEDQLELERWRRRERNIGALTGAD