Identifiers and Description

Gene Model Identifier

Contig5586.0.g36

Standard Name

ERCC3a

Aliases

Contig5586_0_g36

Description

Helicase conserved C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIL143C7.996875492733741e-171SSL2 SGDID:S000001405, Chr IX
from 83041-80510, Genome ...
T. thermophilaTTHERM_004008212.998543574353313e-72rad25/xp-B DNA repair helicase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5586.0.g36(coding)
ATGGACTAGAGATCATCTAGTTATATTGGTGATCAGTAAGAAATGACAGATAGAGATTTG
TTTGACAACTAGGAAGATTTCGAAGAGGGAAATTTCTTTCATAGAGAGTTCCAAGATTAC
ACACAACAGATCAAACTAAAAGAAGATCACGAAAAGAGACCTATTTGGATTGGGCCTAAC
TTTAAACTCTATCTTGAATCATTCTCACCTCTCTACAAAGCAGCTACAGAATTCATGATT
GCAATAGCTGAGCCTGTTAGTAGACCGACTTACATTCACGAATATGTGCTAACAGCGTAT
TCGCTATATGCAGCCATGAGTGTAAATTTGACGAAGGATGACATCTTTGAGGTGTTAGAT
AGACTATCGAAAAATGCGGAAATACCACCTGACGTAAAAGGATTCATTGAGTAATACTCA
AGTAGATATGGAAAAGCTAAGTTAGTTCTAAAAAGCAACAAATATTTCATTGAGACTAAT
GATAAAAATGTCAGAAGGAATTTACTGAACATCTAACAAGTAGCTTCAGCTTATCAATCA
TAGATTGAGAAGAATCGCCTTGAGGAATAGCGATAGAAGGAGAGAGCTGAAAGGAACATT
AACGTTGTTGAAAGCTCAGAGGCAAGGGCTCTAAGAGACAGGTTAATGGGAGTGAATTCA
TATTCAACATCCTCACAATTAAACAGGGCTTCAACTGCAACAGGTACTACTGGAGGGCAA
CAAATATTGACTTAAAATATTGAGTAACAGGATTTGACAGAACGATTTATGAATCTTAAA
GATGAATTCTAAATCTTCATTGATTAAGAAATGGAAGATGTAGATACTAATGAAGGAGGC
TAGGATGGCAACAGTGTTGATGCAAAGGCTTTACAGCGAAGAAAGGAAGAATTAATTCTG
GAAATTGATGCTGAAAAGATTGAGGAAGTTAAGGAGGCATGTATTAGGCTTAACTATCCT
CTTATTGAAGAATATGACTTTAAACGAGATTAAACTATTCCAGACTTAAAAATAGAACTT
AAATCTACCACCTAGATTAGAAGCTATTAAGAATAAAGTCTGAGTAAGATGTTCAGTAAT
GGAAGAGCAAGATCCGGAGTTATTGTACTTCCTTGTGGTGCTGGCAAGACCTTGGCAGGA
ATTATTGCAGCTTGTACTGTAAAAAAGAGTACTATGATTCTTTGTACCAGTGATGTGTCA
GTCCAGTAATGGAGACAATAGTTTTATCAATGGTCAAATATAGCAGGAAAGGTTTGCAGA
TTCACTTCTAGAACAAAGGATCCAATGTTTGAATCTAAAGGTCCAGACTCAGAAGCTGGT
ATTGTTATTTCATCTTACAACATGATTGCGTATCTAGGTAGTAGATCTGGTTAAACTCAA
AAGATAATGGATACTATAAGAAATACAGACTGGGGCCTCCTGATTTTGGATGAAGTCTAA
GTTGTTCCAGCTGAAATGTTTAGAAAAGTTTTAGCTATTTGTAAATCTCACTGCAAACTT
GGATTAACTGCTACTCTAGTACGTGAAGATAATAAAATTTAAGATCTTAACTTCTTGATC
GGGCCTAAACTTTATGAAGCTAACTGGCTAGATCTGCAAGAATAAGGCTTTCTCGCTAGA
GTCTAATGCATTGAAGTTTGGTGTGAGATGACAACAGAGTTCTATAGAGAATATTTAAAT
CATAATCTTAAGCCAAGAATGAAGCAGGTATTGTACGTCAACAACCCAAACAAATTCCTG
GCATGCTAGTATCTAATCAATCTTCACGAAAGCAGGGGCGATAAAATTATTGTATTCTCA
GACAACTTATTTGCTCTCAAAATGTATGCTAAGAAATTGAAGAAACCATACATCTCAGGT
GATGTTAGTTAATCAGAAAGAATGGGAATTTTACATTATTTCCAAAAGACTAATGAAATC
AATACTATTTTCCTGTCAAAAGTAGGAGATACATCAATCGATCTCCCGGGTGCAAATGTG
ATTAATTCAAATATCTTCCCATTTTCGCTTCTCGTCGTTAGGAAGCCCAGCGCCTTGGAA
GAATTCTCAGACCTAAACAAGGCGGAGAAAGCAAGCTTACTCTAACTTCGAAGATTCAAT
GCCTATTTCTATTCTCTAGTCAGCACAAATACCTAAGAAATGTACTATGCAGATAAGAGA
CAGCAGTTTCTGATTGATTAAGGTTATTACTTTGAAGTCATATAGGAATTGCCCTTCCAA
AAAGACCCCTTGCAATTGTAAAAATTGCAGATGACTACAATCAGAGAGCAAGTTGACTTC
TTAACTTCCATTCTACAAAACGATGAGACTAAGTTTGAAAGGGAAGAAGAGCAGGAAGAT
AGAATTGAGGAGGATGAAGATTAACTTGAATTGGAAAGATGGAGACGCAGAGAAAGAAAT
ATTGGAGCTTTGACAGGGGCTGATTGA


>Contig5586.0.g36(protein)
MDQRSSSYIGDQQEMTDRDLFDNQEDFEEGNFFHREFQDYTQQIKLKEDHEKRPIWIGPN
FKLYLESFSPLYKAATEFMIAIAEPVSRPTYIHEYVLTAYSLYAAMSVNLTKDDIFEVLD
RLSKNAEIPPDVKGFIEQYSSRYGKAKLVLKSNKYFIETNDKNVRRNLLNIQQVASAYQS
QIEKNRLEEQRQKERAERNINVVESSEARALRDRLMGVNSYSTSSQLNRASTATGTTGGQ
QILTQNIEQQDLTERFMNLKDEFQIFIDQEMEDVDTNEGGQDGNSVDAKALQRRKEELIL
EIDAEKIEEVKEACIRLNYPLIEEYDFKRDQTIPDLKIELKSTTQIRSYQEQSLSKMFSN
GRARSGVIVLPCGAGKTLAGIIAACTVKKSTMILCTSDVSVQQWRQQFYQWSNIAGKVCR
FTSRTKDPMFESKGPDSEAGIVISSYNMIAYLGSRSGQTQKIMDTIRNTDWGLLILDEVQ
VVPAEMFRKVLAICKSHCKLGLTATLVREDNKIQDLNFLIGPKLYEANWLDLQEQGFLAR
VQCIEVWCEMTTEFYREYLNHNLKPRMKQVLYVNNPNKFLACQYLINLHESRGDKIIVFS
DNLFALKMYAKKLKKPYISGDVSQSERMGILHYFQKTNEINTIFLSKVGDTSIDLPGANV
INSNIFPFSLLVVRKPSALEEFSDLNKAEKASLLQLRRFNAYFYSLVSTNTQEMYYADKR
QQFLIDQGYYFEVIQELPFQKDPLQLQKLQMTTIREQVDFLTSILQNDETKFEREEEQED
RIEEDEDQLELERWRRRERNIGALTGAD