Identifiers and Description

Gene Model Identifier

Contig19698.0.g50

Standard Name

ERAL1

Aliases

Contig19698_0_g50

Description

50S ribosome-binding GTPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007162601.0000521619018958e-77small GTP-binding protein doma
in containing p...
SGDYMR023C0.000009999254677478949MSS1 SGDID:S000004625, Chr XII
I from 321017-319437, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19698.0.g50(coding)
ATGTTAAACCAGTAAGCAGCCCTTCTGAATTAAATTTCTTCAAAGAATGGCTATACATAA
GACAACTCGCCTTAACCAACCAACCCAAATTTAATAATAAAGTCTAATAGAAATCAAGCC
TCATCAATTATGCAAGAACAAATCACTTATGAAGCACTCAATCTAAAAAATATATCTGTA
AATGGAAGAAGTTAAATTCCTGCTAAAAGCTAGGATAACTCCACTAAAAATTAAAGCACA
GAGAATTAAAGAAATATGTTGATTTAAGAATTATAAGCTCCATAGATACTGCACACTAAA
ATAGTAAGAAGCCAAGAATAAAGAGATTCTATAGTTTCTGGAGACAGAATAAAGTAAATG
CTTCAAAAACGAGGTTCAGTGTTTAAGAGAAATTAACAAGAAGATAATCAAAATTTACTG
GTGAAAGAGATTCAAAAAATAAAAGGCAGGAATAAAAGCTAAAGTCTAAATACTCACAAT
AACCAAGCAAGTAAAAGTCTACCTAACAAGAGCAAGCATCATCGTTAGCACTACGGTTAA
AATGAAGATATGTATGATTAATAAAACTATGTGAAGCTAAAATAGTTGCTCTAATCGAAA
TAAACTTTGGATTATGATAGATATAGCAACATTGATTCTGTCCAGAAAAGTGTTCCTGAT
TTTCAAATAAATCCGTTAGATCTCAATCAACCTCTATCTCAGTTTAATCTCTATGAAAAT
GAGAGAGCCTAGCCCTACTTTTAAAATCTTATGGTAAGAAGTATAGAAGGCACTAATGCT
TCTTAAACAAGAGCTTAATCGCGATAGGGAGTTGTAAATAAATCAACAAATAATGCAATG
ATAATAAGAGATTAATACGAGAGACCGAACGACAAATTTTTAGGTGAAAGGCTGAAAGAG
GTTAACTTATCACCTAAGCGTATTGAAGACGTTATAAAAGAGAGGAGAATTGAAAGAACG
TCATCAGCGTCAAAGAAATTTCAATCTAGAAAGGTTACTTTGATCTCAAAATTTGCTTCT
AAGGATCAAAAGAACACCCTATACAAACGCTTGAAAAACTTGAAAGAAAATAAGATTTAT
GATGGTTATAATTCAGCAAATTCAGATGCCCTAAAATTGATGACAACTGATGAGAGAATG
TTGGAAGTAAAGCCAGTTTAGCATCCTGAAAATTTGCATGAAAAAGACACAAATATTGTT
TCTTATAAAGTACCACCAAAGAATCTGACTCCATATTACAGTATCCCTGTAGAAGCTTTA
GCCTAACAAGCCCCACCAAGATTTGAAAGCCCCTAAGGCGCTAAACACTTAGATGTTTGT
ATACTGGGAGCACCTAATGCTGGAAAATCTAGCATTATAAATTTCATGGTAGATAGAGAA
ATTTCTGCAGTAAGCAATAAGTACAATACTACTGATGAAGCAGTTCTAGGATTATATACT
GACTACGATACTAAATGCTAATTGGCATTTATTGATACTCCTGGAATAACCAAAGCTAAT
AACTCAATGAAGTCAAAGATTCTAGTGACTAAGGCCTGGGATAAAATTGGTGACTCTGAT
ATGGTTATGTTTGTAGTTGACTCTGTCAAGAAAATTGATTTTGAAGTTAAAGAAGCGATA
AAAAGACTAAAGCAAACTAAAATAGACCCATAGCATTAGAAAATTCTAGACGCTTTATAA
GATGATAGTTTTACTGATGAAAAATTCAGTAAAGGCTTCTATGAAATGACAGAATAAGAA
AAGGAGTTTTAAACATATAATATACCATCATTGCTGATCCTAAACAAGGTAGATCTGGTT
ACTAATAAAGGAAAACTAAGAGACCTTTAAAACGAATTAGAGGATCTTGGGAACTTTGAG
AAAATTTTCCATGTTTCAGCTTTATCTGGTTTTGGACTCGATACTTTAAGAGAATACTTG
AAATCAAGAGCTAAATTGGGAAAATGGGAGTACCATCCAGAGCTTAAGAGTAAATAGAGC
GAGGTTGAAAAAGTCGAGGAAGCTATGAAACAAGCGATTTATGAAAAATTTTTTAAAGAA
CTTCCTTATCAAGTAGGTATTAAATGTGTAGGATGGGTACCAAAGCTTAACGGAGAGCTT
AGAATTGACGTAGCTTTAGACGTTAAGAATGATGTATAAAAAGGTATGCTTCTAGGGGAG
CATGGTAGAATCATTAGATAGGTCAGAGAAAGGGCTACTCAGTTGCTTGTTGAGAAAATA
TAGAGACCTGTTTCCATGTTTGTAGAGGTCAAAATTAGAAGAAATGAAATCTCAAGTCAG
AATAAGTTTGATAGTATGGAAGGAGTTGCTAGTAAGAAGAGAGTTGAAAGTAAAGAACAA
AATATGCAGTTATATGAGGGGTAGTGA


>Contig19698.0.g50(protein)
MLNQQAALLNQISSKNGYTQDNSPQPTNPNLIIKSNRNQASSIMQEQITYEALNLKNISV
NGRSQIPAKSQDNSTKNQSTENQRNMLIQELQAPQILHTKIVRSQEQRDSIVSGDRIKQM
LQKRGSVFKRNQQEDNQNLLVKEIQKIKGRNKSQSLNTHNNQASKSLPNKSKHHRQHYGQ
NEDMYDQQNYVKLKQLLQSKQTLDYDRYSNIDSVQKSVPDFQINPLDLNQPLSQFNLYEN
ERAQPYFQNLMVRSIEGTNASQTRAQSRQGVVNKSTNNAMIIRDQYERPNDKFLGERLKE
VNLSPKRIEDVIKERRIERTSSASKKFQSRKVTLISKFASKDQKNTLYKRLKNLKENKIY
DGYNSANSDALKLMTTDERMLEVKPVQHPENLHEKDTNIVSYKVPPKNLTPYYSIPVEAL
AQQAPPRFESPQGAKHLDVCILGAPNAGKSSIINFMVDREISAVSNKYNTTDEAVLGLYT
DYDTKCQLAFIDTPGITKANNSMKSKILVTKAWDKIGDSDMVMFVVDSVKKIDFEVKEAI
KRLKQTKIDPQHQKILDALQDDSFTDEKFSKGFYEMTEQEKEFQTYNIPSLLILNKVDLV
TNKGKLRDLQNELEDLGNFEKIFHVSALSGFGLDTLREYLKSRAKLGKWEYHPELKSKQS
EVEKVEEAMKQAIYEKFFKELPYQVGIKCVGWVPKLNGELRIDVALDVKNDVQKGMLLGE
HGRIIRQVRERATQLLVEKIQRPVSMFVEVKIRRNEISSQNKFDSMEGVASKKRVESKEQ
NMQLYEGQ