Identifiers and Description

Gene Model Identifier

Contig4252.0.g99

Standard Name

EPRSc

Aliases

Contig4252_0_g99

Description

Anticodon binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03129 ) Anticodon binding domain
  • ( pfam09180 ) Prolyl-tRNA synthetase, C-terminal
  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004870202.0002969069156684e-168prolyl-tRNA synthetase family
protein
SGDYHR020W6.999646166012048e-157YHR020W SGDID:S000001062, Chr
VIII from 143996-146062, ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4252.0.g99(coding)
ATGTTCGTAACTGAAGGTGCACTTAGCAAGGAAAAAGATCATATAGAAGGTTTTGCCCCT
GAAGTTGCTTGGGTTACTAGATCTGGAGATACTGAATTAAATGAGCCAATTGCAATTAGA
CCTACCAGTGAGACTATTATGTACCCAAGTTATGCTAAATGGATACAATCATACAGAGAA
CTGCCACTTCTCTTAAATTAATGGTCAAATGTAGTAAGATGGGAATTTAAACATCCAACA
CCCTTTATAAGAAGTAGAGAATTTCTGTGGCAAGAAGGTCACACTGCTCATGAATCATTA
GAGGAGGCCGAATAAATGACGCATAAAATTTTGCAAATATACGCTGACTGCTATAGAGAT
GTCCTTGCATTGCCTGTAATACCTGGTCTTAAATCCTAAAGTGAAAAATTTGCAGGAGCA
GATTATACAACCACAGTAGAATTAATTGTACCTCAAAATGGAAGAGCGATTTAAGGAGCT
ACATCACACAATTTAGGACAGAATTTTGCTAAAATGTTTGAAATCCAGTTTGAAGATAAA
CACTCCTAGAAATAGTTTGTTCATTAAACTTCATGGGGGTTATCTACAAGATCTATAGGT
GCAATGATTATGATACATGGAGATGATAATGGATTGATTTTACCACCTGCTGTTGCAGAA
ACATAAGTAGTAATTGTTCCCATTAAAAATAAGGGCATTGAAGAGGAACTCTTTAAATAG
AGATATGAAAACATTTATTAATAGCTTAAAAGTAGTGGCATTAGAGTTGTACTTGATGAT
AGGGAAAACTACAAGCCTGGCTGGAAATTTAATCATTGGGAACTTAAAGGAGTTCCAATT
AGAATAGAGCTTGGTGAAAATGATTACAGAAATAATCAAGTCACAGTTGTTAGAAGAGAT
ACTGGTGTAAAGGAACTAATTTCTAACGATAGCTTGAATCAAACAATTAGTTAGAAGTTA
AACACAGTCCAGCAAGATATGTATGAGAAATCCCTTGAAATAAGAAACCAAAGAATTACA
ATGGTATAAAACTGGAGTGATTTCATGGATTAAATCAATAAAAGAAATTCTGTGCTAGCT
CCATGGTGCAATAGTTAGGATTGTGAATAAAACGTAAAGAGACAATCTAAGTAAGATTCT
GATGTTGGAGGTGAGGATCATGATGAGATGATGCTAACAGGTCAAGCGAAAACAATGTGT
TTGCCATTTGAAAATAACAAAGATTTTAAAAATTAATACTCAGATTGTAAATGCTTTTAC
TGTAAATAACCAGCTCAAGTAATAGCATTATGGGGAAGATCATATTGA


>Contig4252.0.g99(protein)
MFVTEGALSKEKDHIEGFAPEVAWVTRSGDTELNEPIAIRPTSETIMYPSYAKWIQSYRE
LPLLLNQWSNVVRWEFKHPTPFIRSREFLWQEGHTAHESLEEAEQMTHKILQIYADCYRD
VLALPVIPGLKSQSEKFAGADYTTTVELIVPQNGRAIQGATSHNLGQNFAKMFEIQFEDK
HSQKQFVHQTSWGLSTRSIGAMIMIHGDDNGLILPPAVAETQVVIVPIKNKGIEEELFKQ
RYENIYQQLKSSGIRVVLDDRENYKPGWKFNHWELKGVPIRIELGENDYRNNQVTVVRRD
TGVKELISNDSLNQTISQKLNTVQQDMYEKSLEIRNQRITMVQNWSDFMDQINKRNSVLA
PWCNSQDCEQNVKRQSKQDSDVGGEDHDEMMLTGQAKTMCLPFENNKDFKNQYSDCKCFY
CKQPAQVIALWGRSY