Identifiers and Description

Gene Model Identifier

Contig15844.0.g111

Standard Name

EPRSb

Aliases

Contig15844_0_g111

Description

Anticodon binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03129 ) Anticodon binding domain
  • ( pfam04073 ) YbaK / prolyl-tRNA synthetases associated domain
  • ( pfam00587 ) tRNA synthetase class II core domain (G, H, P, S and T)
  • ( pfam09180 ) Prolyl-tRNA synthetase, C-terminal
  • ( pfam12410 ) Poxvirus DNA dependent RNA polymerase 30kDa subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004870209.997093137033517e-262prolyl-tRNA synthetase family
protein
SGDYHR020W9.997093137033517e-262YHR020W SGDID:S000001062, Chr
VIII from 143996-146062, ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15844.0.g111(coding)
ATGGCAGAAGCAAAACCAACCCTAGTTATAAGCGATATTGAATCAACTGAGAAGTATCTA
ACTGAAAAAGGAATCTCATTCAATACTATAAGACACGAAGCTGTTGCAACAGTAAAAGAA
GGTCTTGAGAAAGTAAAGTTCGAAGGAGAATATGCTGATTCAGTTTTTGCAAAGAACCTG
TTCTTAGCAAACAAAAAGAAGAAGGATTAAATTTACTTAGTTGTTGCAGCTCACGATACT
GAAATCGATATGAAGGCATTGACTACTCATTTCAAAGCTGGCTCAGGGAATTTAAGAGGA
GGTGACGAATAAGTCATGGAAGATTTATTGGGAGTTAAGAAAGGATCAGTCAACTTATTC
TCAATTCTAAATGATACTGGTAAAAAGATTCATCTTGTATTGGATCAAAGACTTGTTGAC
GCTAAAAGAGTAGCTTTCCATCCAATGCAAAACGATGCTACTACTTCAATCACTTCAGCT
GATGCTTTGAAGATTGCAGAATTGGCTGATCACAAGCCAGAAATAATTGATTTCTCAAAG
CTTACCGAAGCTGCTGCCGCCCCAAAGAAGGAAGAAGTAAAGAAGGGAGCAGCAAAAGCA
AAGAAAGATGAAGGTAAAATTGAGGATGCTAAATAGATTGGTATTGAATACACCAAAGAA
TAAAATTTCTCCAAATGGTATCAATAAGTTATTACCAAGAGTGAGATGATTGAATACTAT
GAAATCTCAGGTTGTTATATCTTAAGACCCCTTTCATACTTTATCTGGGAAAGTATTTAA
GGATTTTTAGATCCAAGATTCAAGAGAAACGGAGTTTAAAACTGCTACTTCCCCATGTTT
GTATCTGAAGCTGCCTTAAGTAAGGAGTAAAATCATATTGCTGGATTCGCTCCAGAAGTT
GCCTGGGTAACCAAGTCAGGTAAAACTGATCTTGCTGAACCCATCGCCATCAGACCAACA
AGTGAAACAATCATGTATCCAAGTTATGCTAAATGGATTCATTCTCATAGAGATTTGCCA
TTATGCATGAATCAATGGACAAACGTTGTCAGATGGGAATTTAAGCATCCAACTCCATTC
ATTAGAACTAGAGAATTCCTATGGCAAGAGGGTCACACTGCCCATGCCACAACCGAAGAA
GCTGATGAAATGGTATTAAGTATTCTTGATTACTATGCAGATTGCTACAAAGAGATGTTA
GCTGTTCCTGTTGTCAAGGGAAGAAAATCAGAGGAAGAAAAGTTTGCTGGTGCTAACTAT
ACCACCACTGTTGAACTTTATGTTCCCGCAAACGGTAGAGGTATTCAAGGTGCCACATCT
CATTAATTGGGATAGAACTTTGCTAAGATGTTCGATGTTTGGTTTGAAGACAAAGTTGGT
CAAAAGTAATTTGTTTGGTAAACTTCATGGGGTTTCTCAACAAGATCTATTGGCTCAATG
ATTATGGTTCATAGTGACAATAAGGGTCTTGTAATTCCTCCAAGAGTTGCTTAAGTTTAA
GTAGTTATTGTCCCCATTACTTTTAAGGATGATGATCCAGAACAAATGACTGGAAAGGCC
AATGAATTATTCAAGTCCTTGAAAGCAGCTGGAGTGAGAGTTTACTGCGACGATAGAGAA
AATTATAACCCAGGATACAAATACAATCATTGGGAACTGAAGGGTGTTCCCATCAGACTT
GAGCTCGGTAAGAAGGATTATGACAAGCAAGAAGTTAGAGTTGTGAGAAGAGACAACGGT
GAAAAATCACAAATGAAATGGGCAGATCTCGTTAATGAAATTCCTCAATTGCTTGAAAAG
ATTCACAACGACATGTATGAGAGAGCTCTAAGAATCAGAGATGATCATATGATTGACGCT
TCAACCTGGGAAGAATTTATGACTGCTCTTAATGGCAGAAATATTGTTCAAACTCCCTGG
TGCAATAGCCAAGAGTGTGAAACCTAAGCTAAAGATAAATCAAAGGAAGAATCCCTAAAA
ATTATGGAAGAAGCTGGTGAAGATGAAGAAGTCTTAACTGGATCAGCTAAAACTCTCTGT
ATTCCCTTCACTCCAAAAACTCCTCTTGTTGCTGGTGAGAAATGCTTCCACTGTGGTGCA
GAGGCTAAAGTCAAAGCTCTCTGGGGTAGATCATATTGA


>Contig15844.0.g111(protein)
MAEAKPTLVISDIESTEKYLTEKGISFNTIRHEAVATVKEGLEKVKFEGEYADSVFAKNL
FLANKKKKDQIYLVVAAHDTEIDMKALTTHFKAGSGNLRGGDEQVMEDLLGVKKGSVNLF
SILNDTGKKIHLVLDQRLVDAKRVAFHPMQNDATTSITSADALKIAELADHKPEIIDFSK
LTEAAAAPKKEEVKKGAAKAKKDEGKIEDAKQIGIEYTKEQNFSKWYQQVITKSEMIEYY
EISGCYILRPLSYFIWESIQGFLDPRFKRNGVQNCYFPMFVSEAALSKEQNHIAGFAPEV
AWVTKSGKTDLAEPIAIRPTSETIMYPSYAKWIHSHRDLPLCMNQWTNVVRWEFKHPTPF
IRTREFLWQEGHTAHATTEEADEMVLSILDYYADCYKEMLAVPVVKGRKSEEEKFAGANY
TTTVELYVPANGRGIQGATSHQLGQNFAKMFDVWFEDKVGQKQFVWQTSWGFSTRSIGSM
IMVHSDNKGLVIPPRVAQVQVVIVPITFKDDDPEQMTGKANELFKSLKAAGVRVYCDDRE
NYNPGYKYNHWELKGVPIRLELGKKDYDKQEVRVVRRDNGEKSQMKWADLVNEIPQLLEK
IHNDMYERALRIRDDHMIDASTWEEFMTALNGRNIVQTPWCNSQECETQAKDKSKEESLK
IMEEAGEDEEVLTGSAKTLCIPFTPKTPLVAGEKCFHCGAEAKVKALWGRSY