Identifiers and Description

Gene Model Identifier

Contig21938.0.g18

Standard Name

EPRSa

Aliases

Contig21938_0_g18

Description

tRNA synthetases class I (E and Q), catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00749 ) tRNA synthetases class I (E and Q), catalytic domain
  • ( pfam03950 ) tRNA synthetases class I (E and Q), anti-codon binding domain
  • ( pfam07189 ) Splicing factor 3B subunit 10 (SF3b10)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL245W9.999341372639941e-153GUS1 SGDID:S000003214, Chr VII
from 39023-41149, Genome...
T. thermophilaTTHERM_004206808.99958851839629e-149glutamyl-tRNA synthetase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21938.0.g18(coding)
ATGGTTGAGGCTACTGCTTAAATTAAGACTACTAATTACGATGACCCAGTCTACGCAAAG
TTCAAGAACGTCTTGAAGGGTGCAAAGAAGGGAGAGGTTGTAACCAGATTCCCACCAGAA
CCATCAGGTTACTTGCACATTGGTCACGTCAAGGCTGCTATGTTAAACTACCATTATGCC
AAGATGTACGAGGGTCAAATGATCTTGAGATTCGACGATACCAATCCCATGAATGAAAAG
ATTGAGTTCGTAGAGAACATCATTAGAGATTTGAAGACTCTTGAAATTCACCCAGATAGA
GTTACTTACACTTCTGACTACTTTGATCAAACTAAAGAGTATATGGAGCAACTTATTAGG
TTAGAGTTAGCTTACGCAGATGACACCCCAGCTGAAGAAATGAAACTCTAGAGAGATGCT
GGAACTGAGAGCAAGTACAGAGAAGCAACTGTTGAAGAGAACATGACAAGGTTCCATCTC
ATGCTCAAAGGATTGAAGTTTGATCCTAAATCACAAGAAGAAGAGAAGAAAGGAGGTGAG
GAGAAGAAAAAGAGTGCTAAAAACAAGGAGGAGAAAAAGAAAGAGAAGGAAGAGGCAAGA
GCTGCAAAGGCTGAAGTTGTTTCAGATTGGTGCATGAGAGCAAAGTTAAATATGCAAAAC
CCAGTCAAATGTCTGAGAGATCCAGTATTCTACAGAATCAAGAGAGAAGCACATCACAGA
ACTGGTACCAAGTATTTAGCTTACCCAACTTATGATTTCGCCTGTCCAATTGTTGACGCT
CTTGAAGATGTTACTCACTGTTTAAGAACTATTGAGTATCATGATAGAAATGCACTTTAT
GATTGGGTACAAGAGAAACTTGGTTTAAGAAAGGTTGCCTTATATGACTACTCAAGACTT
AACTTAGTATCAACTGTTCTCTCTAAGAGAAGCTTGAAATGGTTCGTTGAGTCTGGTCAT
GCTGAGGGCTGGTACGATCCAAGGTTCCCAACTGTCCAAGGTATTATGAGAAGAGGACTT
ACTGTCGAAGCTTTAAAGCTTTTCATGCTTGAGCAAGGTCCATCAAAGAATACTAACTTG
ATGGAGTGGGATAAACTATGGGCCTTAAATAAGCAATATATTGACCCTATTGCTCCAAGA
TACACTGCTATTGTTAAAGATTCAGCTGCTAAAGTTATTCTTGAGAATGTTCAAGATGAA
ATTGAAGCTAAATCTGTACCACTTCATCCAAAGAATGATGCCATCGGATCAAAAGCTCTG
ATTTTTGGAAAATACTGTTGGATCGAAAAGGATGATGCTGATACCATTAATGAGGGTGAA
AAGATTGCCTTGAGAAACTACGGCAAAGTACTTATTACTAAGAAAGATACAGTTGAAGGT
ATTACAACCCTCTACGGTACACTTGATCTCGAGGACAAGGATTTCAAGAAAGCAAAGGTT
ATTACTTGGATTTGTGCTGATGATTCTACTACTATCGAGTTAGAGTTGATTGAATATGGC
CCTCTTATCAATAAGAAGAAGATTGAAGAGAAAGACGATGTCACCCAAATTGTTAACCAT
AACTCAAAGGTTCAATACACTGCTCTCGCTGAGGGAAGCATGAGACACTTACAACATGGT
CAAATTATTCAATTAGAGAGAAGAGGTTTCTTCTATGTAGATCAATTTGCTCACGGTGAC
AAGAAGCTCATTTTGAACTACGTTCCTGATGGAAAAATGAACCCAATGAGTAGACTTAGA
CAAGTACTCGATCAAGCCGATCTTTCAAAGGGTGTTGATCTAAACAAAGTACTTGGAAAC
AATGCTGATAAAAAGAAGAAGGATCAACCATAACCAGCAGTTGGATAAGATGGTCAACCA
GAGGAGGAACAAAAGGTGCAATTAAGTAAGAAAGAACTTGCTGCACTAAAGAAGGCTTAA
AACAAAGCTTTCTTGTAGGGCAAGGGTAAACCAGCCGATCAATAACAAGATCCATAAGAG
CCAAGTCAAGATGCCCCTGCAGACCAATGA


>Contig21938.0.g18(protein)
MVEATAQIKTTNYDDPVYAKFKNVLKGAKKGEVVTRFPPEPSGYLHIGHVKAAMLNYHYA
KMYEGQMILRFDDTNPMNEKIEFVENIIRDLKTLEIHPDRVTYTSDYFDQTKEYMEQLIR
LELAYADDTPAEEMKLQRDAGTESKYREATVEENMTRFHLMLKGLKFDPKSQEEEKKGGE
EKKKSAKNKEEKKKEKEEARAAKAEVVSDWCMRAKLNMQNPVKCLRDPVFYRIKREAHHR
TGTKYLAYPTYDFACPIVDALEDVTHCLRTIEYHDRNALYDWVQEKLGLRKVALYDYSRL
NLVSTVLSKRSLKWFVESGHAEGWYDPRFPTVQGIMRRGLTVEALKLFMLEQGPSKNTNL
MEWDKLWALNKQYIDPIAPRYTAIVKDSAAKVILENVQDEIEAKSVPLHPKNDAIGSKAL
IFGKYCWIEKDDADTINEGEKIALRNYGKVLITKKDTVEGITTLYGTLDLEDKDFKKAKV
ITWICADDSTTIELELIEYGPLINKKKIEEKDDVTQIVNHNSKVQYTALAEGSMRHLQHG
QIIQLERRGFFYVDQFAHGDKKLILNYVPDGKMNPMSRLRQVLDQADLSKGVDLNKVLGN
NADKKKKDQPQPAVGQDGQPEEEQKVQLSKKELAALKKAQNKAFLQGKGKPADQQQDPQE
PSQDAPADQ