Identifiers and Description

Gene Model Identifier

Contig7560.0.g104

Standard Name

EPC1b

Aliases

Contig7560_0_g104

Description

NHR1 homology to TAF

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000490000.00010003404299092957hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7560.0.g104(coding)
ATGATAGAAGATCAAGAATTTGCAAAAATAAAGAATATCACTGTTGAATAACTTTGCATG
ATTATTGATATTTACGAAAAACTATCAGGACCATTATAGTCTAAAACTCAAATTCAAAAT
TTGATTTTAGAATCAGATATATAGGCTAAAATTCCTAAAGTAAAGCCAAATTTCAAATAA
GAGTTTGATATTCTAGGCAAACGGGAAATATAGAAAAATGAGTAAAATGAACTCTTAAGA
GACATTTATAAGTATTGGAGAAGGAAAAGAGATTAGAGAGGGTCATCTCTTTTAAGAAGA
TTTTGGAGGAGATATGATTTCACTTCAGAAGATAATTATGCAATTTTCAGAGATAGATTT
GAAGAAAAAACAATGAAGTTAAGAAAAAAACATAAAACTGAAACTGATTCTTATTTTAAA
GTCAGAGGACTTTGTTCAAATTTGGTTTAAGCTCTTGGGCTTTGCCATGAAGTTGTAAGT
GAATTGGAGCAAGCATTTAAAAGCTAAGTGGGGCCTAATTACTTAAACTTTTTAAATGAT
GATATTGAAAATGACTTGAAAGTTCAATGCTCCAAATATGTCAATTTCTATGAGTCAGAG
ATAAGATAAGAGAGATATCCAGAAATTCTATAGATATAATAGCAGCTAATTGATGAAGAA
CCACGGTTTCTGGAAATTGATAGCAGTTGTATGGACCAGAAAATAAGCAAACTCAAGTAT
GAGCCTGAAAAAGAGAAATCTAACAAAAAATACTAGAAAGGGCACAATAAACAGCGCAAG
CTTCACTTGAACTTGGAAGCAATAAAAAGAAAAGAAAGTAACCACGAGGAATTATTGCAG
AAGTTCTTCTTACGACGACGGCTCCGAAATTAAGGCAGAGGATGA


>Contig7560.0.g104(protein)
MIEDQEFAKIKNITVEQLCMIIDIYEKLSGPLQSKTQIQNLILESDIQAKIPKVKPNFKQ
EFDILGKREIQKNEQNELLRDIYKYWRRKRDQRGSSLLRRFWRRYDFTSEDNYAIFRDRF
EEKTMKLRKKHKTETDSYFKVRGLCSNLVQALGLCHEVVSELEQAFKSQVGPNYLNFLND
DIENDLKVQCSKYVNFYESEIRQERYPEILQIQQQLIDEEPRFLEIDSSCMDQKISKLKY
EPEKEKSNKKYQKGHNKQRKLHLNLEAIKRKESNHEELLQKFFLRRRLRNQGRG