Identifiers and Description

Gene Model Identifier

Contig22626.0.g40

Standard Name

ENY2

Aliases

Contig22626_0_g40

Description

Transcription factor e(y)2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002959908.002082816694397e-20hypothetical protein
SGDYBR111W-A 139.7

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22626.0.g40(coding)
ATGAACTCCCAACACAACACTGATATTGCCCTTAAAAAGAGTCTCATTGAAAAGAAGCTC
GAGGAGAGCGGAGAGAAGCAGAGACTTGAAGAATACTTGAGACAAAAGCTAATTGAGTGC
GGTTGGAAAGATGAACTTAAGAAATATTGCCTGGATTTGATTAGAAGCAAGGGTCTTGAG
AAGATCAACTTAGACGACTTGGTTGAGGAATTGTTGCCAAAGGGCAGAGCACTCGTGCCC
ACCAAGATTAAGGAGGACTTACTTGCCAGAATCAAGACTTATCTCGAGAATGACTCTGAC
TACAAGAGACTCACTGGATATTGA


>Contig22626.0.g40(protein)
MNSQHNTDIALKKSLIEKKLEESGEKQRLEEYLRQKLIECGWKDELKKYCLDLIRSKGLE
KINLDDLVEELLPKGRALVPTKIKEDLLARIKTYLENDSDYKRLTGY