Identifiers and Description

Gene Model Identifier

Contig18250.0.g7

Standard Name

ENP1

Aliases

Contig18250_0_g7

Description

Bystin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR247C1.0000521619018958e-77ENP1 SGDID:S000000451, Chr II
from 714455-713004, Genom...
T. thermophilaTTHERM_002184803.0014802379878627e-60Bystin family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18250.0.g7(coding)
ATGGGAAAGGGTGACTTAACAAATCCAGTGAAATCCTCAAGTAAGGGTAGTGGAAACAGA
CGTGATTAAAGAATGAAGAAAGTTGTCAAGAAAAACATCTCTAAGAAGGATGCTGATAGA
GTGGCAAAAGTAAAGAAATATCAGAAGGCAGAGAAAATAAAGGAACGTAAGGCTAATAGA
GAAAACGAGTTATAAATGAAAAGAGCCGAAAAATTAGCTGTGAAGGGCAAGCTACATAAA
AAGAAGGGAAATGGCGATGATGAAGATGAATGGGAAGATATGGTAGATGAGCATGAGAAG
GACGTATTTGATAAAGACGGTTACTTTGATGTACCAGAGAGTGAGCACAATCAAATTTCT
AAGAATGATGAGAAACTATTGCAAGTGCTTAATCAAAAGAAGGCAGATAAATCAGGCAAG
AAGCAAAGTGAAGAACCAAGCACTGGTCTCAATTTAGCCGATCTGATTATGCAAAAGCTT
TAAGCTGGCTAGTTCTAAGATGGTAACAATGCTGAAAAGAAACCACCTAAGTATGAAGAT
TTAGAGGAAGGTGTAGCTTCAACACTTGACCCAAAGCTTGTTGCAGCCTATAAATCTCTA
GGTACAATTTTGAGATCTTACAAATCAGGAAAGTTACCAAAACTTTTTAAAGTCATTCCT
CAAGTTGCCAACTGGGAAGAATTATTGTTCCTGACTAAACCAGAATAATGGTCAGCTGTC
TCTACTAGAGAAGCAACTAAAATCTTCTGCAGTAATTTGAACTCAAGAATGACTCAGAGA
TTCTATAATCTCGTCCTATTACCAAATGTCAGAGAAAATATCAACACTTATAAGAAACTT
AACTATCATTTGTATATGGCACTTAAGAAATCACTATTTAAACCAGGTGCTTTTTTCAAG
GGAGTTTTATTACCAATTGCTGAAGATGCTACAAGCAGAGAAGCTGTTATTATAGGTAGT
ATTTTGGCAAAAGTAAGCATTCCAAGTATTCACTCTAGTGCAGCCTTGATTAAGCTTACA
GAAATGGAATATAATATTGGTACAGGCTACTTCATTAAAGTTTTGATAGGCAAAAGATAC
GCCTTACCTTCTCAAGCCGTAGATATGCTCGTTGATTTCTTCTGCAAGTTTGGATTACCT
GATGAAGAAACCGATGATGAGACAAAGTTTGGCAAGATCCCAGAAATGCCAGTCATGTGG
CACTAGACACTTCTCTCCTTTGTATAAGGCTACAAAATGAGTTTAAATGAATCACAGAGA
AGAAAACTCAAGGCTCTTTTGAAGGTTCAAATTCATTATTTAATTACACCTGAGATCAGA
AAGGAACTTTTTAGTATTAGTGTGAGTGGAGCAGTCAAGTCAAACCAGATTGGTCAGGAT
GAGGATGAAGAAATGGATATGGATTGA


>Contig18250.0.g7(protein)
MGKGDLTNPVKSSSKGSGNRRDQRMKKVVKKNISKKDADRVAKVKKYQKAEKIKERKANR
ENELQMKRAEKLAVKGKLHKKKGNGDDEDEWEDMVDEHEKDVFDKDGYFDVPESEHNQIS
KNDEKLLQVLNQKKADKSGKKQSEEPSTGLNLADLIMQKLQAGQFQDGNNAEKKPPKYED
LEEGVASTLDPKLVAAYKSLGTILRSYKSGKLPKLFKVIPQVANWEELLFLTKPEQWSAV
STREATKIFCSNLNSRMTQRFYNLVLLPNVRENINTYKKLNYHLYMALKKSLFKPGAFFK
GVLLPIAEDATSREAVIIGSILAKVSIPSIHSSAALIKLTEMEYNIGTGYFIKVLIGKRY
ALPSQAVDMLVDFFCKFGLPDEETDDETKFGKIPEMPVMWHQTLLSFVQGYKMSLNESQR
RKLKALLKVQIHYLITPEIRKELFSISVSGAVKSNQIGQDEDEEMDMD