Identifiers and Description

Gene Model Identifier

Contig36.1.g124

Standard Name

ENDOV1

Aliases

Contig36_1_g124

Description

Endonuclease V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002838404.001670058321624e-73Endonuclease V family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig36.1.g124(coding)
ATGGAATCGCTTGCTTAAAAAATTGAAGATATCTCTCTATAGTAAAACTCACAATAAACT
GTGGAAGAGGAAGTGAAGGCGTCTGCAGATTGGGGTTAATTCAATTTTAAAGCTGGAAGT
TAAAATGCAGAAGCCAAGGTTATTGCGAACGCTAATCATGGAGATGTAGAATAAAAGCAG
CAAAAACCCTATAAATCAAAGAAATAATCCAAGTTTGATAAATTACAGGAGGAAGTAGAT
GAAGAAGTTAGAGATAAATGGATGTTGGAATAAAATACTCTAAAGCAGTAACTCATTGAG
GATGAGGATAAATTCAGTTGGGTGATAGATCCTAGTAATTATAGCAATAGCACTCTCAGG
TATATTGCAGCTATTGACATTAGCTACTCAAAAACAGACGACAGGAAAGCCGTTGCAGCT
CTGATAGTATGTCAATATCCAACAATGAAAATACTATACGAGGACTTTGAGAAGGAGACA
GCTGACTACCCCTACATCCCAGGTTTCCTAGCTTTCAAGGAAGTACCAGTTTATTCCATA
TTATTTGATAGATTGAAAGCCAAAGAACCAGATCTGTGGCCAGATGTGCTCTTAGTGGAT
GGCAATGGAATCTTACACACCAGGGGTTTTGGGTGTGCTTCACATGTGGGAGTGTTGCAA
AACTTACCCTCTATTGGAGTTGGCAAGACTGTATTTGCTGTTGATGGATTGACTCAATTA
GGTGTAAAAGATCTATGCGATCAAACTTTATTGAAAGGAGGAGATTTAGTTAATTTAGTT
GGTAAATCTGGAAAAGTATGGGGAGCTGCATTGAGAAGCACTTCAGACAGCAAAAATCCA
ATTATAATCTCTGTAGGGCATCGTATAACTCTATAAACAGCAATTGATGTGGTAAAAGCA
TGCATTAAGAAAGTCAGAATACCAGAGCCAATTCGCCAAGCAGACTTGAAGTCAAGATCA
CTTGTTAAGAAATTCTATGATTCTGATAATGGCGTAGAGCAGAAAGAAGGGTGGAAAAAT
AAGGGACACAAAGGAAAATATGACCATCATAAAGACAAAAAGGATCAAGTTTAATGA


>Contig36.1.g124(protein)
MESLAQKIEDISLQQNSQQTVEEEVKASADWGQFNFKAGSQNAEAKVIANANHGDVEQKQ
QKPYKSKKQSKFDKLQEEVDEEVRDKWMLEQNTLKQQLIEDEDKFSWVIDPSNYSNSTLR
YIAAIDISYSKTDDRKAVAALIVCQYPTMKILYEDFEKETADYPYIPGFLAFKEVPVYSI
LFDRLKAKEPDLWPDVLLVDGNGILHTRGFGCASHVGVLQNLPSIGVGKTVFAVDGLTQL
GVKDLCDQTLLKGGDLVNLVGKSGKVWGAALRSTSDSKNPIIISVGHRITLQTAIDVVKA
CIKKVRIPEPIRQADLKSRSLVKKFYDSDNGVEQKEGWKNKGHKGKYDHHKDKKDQVQ