Identifiers and Description

Gene Model Identifier

Contig16524.0.g89

Standard Name

EMB2738

Aliases

Contig16524_0_g89

Description

50S ribosome-binding GTPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002421891.9993404840605158e-133GTP-binding protein enga
SGDYMR023C0.0000000000009003435339752751MSS1 SGDID:S000004625, Chr XII
I from 321017-319437, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16524.0.g89(coding)
ATGTTCACATAAGCTCTATTTTCTCTAAGAAACAGGACTCATCTAGCAAGAAATAACTTA
AGTTCATTAATCAACCCAATATCTAATAGCTTCTAAAATACTTAATTGTTGATTTAAAGC
CAGAGATAATTTAGTAATTATGAAGAATAGAGTGTGGAAAGTATTATTGAGAAACCATTA
AAAAGAAATAATACAAGGGATGGTATTAATAGTAATCCACTCAAACCAACTACTTTGAAG
GACGATATATACACGATTTCAATCATAGGGAGACCAAATGTGGGTAAATCAACTTTATTC
AATAGATTAATGGGTAAAAAACTTGCATTAGTTGATAAAATGCCTGGACTTACTAGAGAT
AGAAGAGAAGGACTCACTCAGTTATTTGATATTCCAATCAGATTGGTAGACACTGCGGGG
TATGAATAATTAGAGGGTTAAGACAATAAAGCTTTAGAAAGGAGACAATTGAATTAAAAC
ATGCTATAAGAGATGATGAAATAAACAAGGAACGCTCTTATTTACTCTGATCTTGCTCTT
TTTATATTGGACAGCAGGGAAGGCATAAACTACAACGATGTGGCTATATATAAATGGTTA
ACTTATCACTCACTCAAACTTCCACAAGAACTCAAGAAACACAACTAATAACTCACTAGA
CTATCTGAGTAGGAAAGGTATGAGTAGATAATGAGTGAAGAAGACTAAAAGTATAAGCAA
AAGATCAACGAAGACATATTAGTGGATCCAAACGATGCACACGCCTAATCATTGCTGAAG
AAGTAAAAGTTTGATAAACAAAAATTCAAGTTGGATTAGAGGATGCAGGAGTTTAAGAAG
CAATTTAAAAACATTGATGATTAGTTTATGGATGGCATGGAAATGAAAGTACCAGAGATA
TTGTTCTTAGCTAATAAAAGTGAGGATGGCTTTGAAGGAGATATGCTTGCTGATTTCTAC
TAGATGTTCCCACACATCTCGGAACCTGATGAGTATGGAAACGTAAAAGAACCAATATTC
ATCTCTGCTGAACATGGGGATGGACTGCCAGACTTATATCAACAAATTAAAATAAGAATC
CCATCCACTCACCTAAATAGTAAAGCTAAGATTGTAGATGTTTCCGATGAAGAAAATGAG
GGAAATGAAGGTGGTAATGATATCAAGGGTTAAAGAGATATGAATGCTTTTATCTCACAT
TGGAATAAGGAGTTTGATAGGTTGAATCCAAATCCTGAGGACAATTCAGATTTCGATTCA
GACAATGACATTAACCCCTTAGATACTCTGACTCCAGCAGGTAAATATATGTCCTCCCGC
TAATTATAAATCTCTTCTGACAACTTAATGAAAAAGAAGCCCATCTAATTGAGTATTGTT
GGAAGGCCTAATGTTGGAAAATCCACACTTATCAATGGCCTCCTTAAAGAAAACAGAGTG
ATAGCTAATGACTTAGCTGGTACAACCAGAGATTCAGTTACTATTCAGTGGGTGCATGGA
GGTCGAAGAATTAATTTGGTGGACACCGCAGGCGTAAAACTTGGAAACAGTATAAAAACA
GAGATTGAACAAATGGTCAAAGAATAGGTGCAGTAAAGTATAGACTACTCACATGTTGTT
GTCGTGCTTATTGACTCTATGCAAGCATTTACTAATCATGATATGATGATCATTAAGCAA
GTGCTTGAAGAAGGAAGAGCAGTCGTTATTGCAGCAAATAAATGGGATCTAGTTGAAGAC
AAATACAAAAAGAAGGCTCTCAAGTGGATTGAAAAATAACTTGAAAAAGGTATTGGGCAA
GCTAAGGGAATACCTATTGCTTATATAAGCGCAAAGAATGGTTAGAGAGTTGACAGAATT
ATGGATGAAGTCATGAGAGTTTATGAAAAGTGGAACACTAGAGTATCAACTGCTCTTTTG
AATAAATGGATTCACGCTTTTTAAAGAGTCTAGAAGATGCCAACTGATGAGGGTAAAACA
CTAAAGCTTAGATTTTTAATGCAAATCAAAACTAGACCTCCTACTTTCTTCCTTTACGTA
AACAACAGGTCCCTAATTGATGACACTTTTGAGAGATTCTTACGCAACTCAATATCTAAT
GAATTTGGATTTTAAGGGTGCCCTATGAGAATATTAGTTCGTGATAATAAACTTTAGTAT
GCTCGTAGAGGTCTTGCTTCATTAAATCCTACTACAAGAGCTGTCCTTCACAGAATAGAA
ACTGAAAAGAATAAGAAAAAGAATGTTACATATAGGAGGAGACTTGCAGGCAACAAGTTC
CTTTACAAATGA


>Contig16524.0.g89(protein)
MFTQALFSLRNRTHLARNNLSSLINPISNSFQNTQLLIQSQRQFSNYEEQSVESIIEKPL
KRNNTRDGINSNPLKPTTLKDDIYTISIIGRPNVGKSTLFNRLMGKKLALVDKMPGLTRD
RREGLTQLFDIPIRLVDTAGYEQLEGQDNKALERRQLNQNMLQEMMKQTRNALIYSDLAL
FILDSREGINYNDVAIYKWLTYHSLKLPQELKKHNQQLTRLSEQERYEQIMSEEDQKYKQ
KINEDILVDPNDAHAQSLLKKQKFDKQKFKLDQRMQEFKKQFKNIDDQFMDGMEMKVPEI
LFLANKSEDGFEGDMLADFYQMFPHISEPDEYGNVKEPIFISAEHGDGLPDLYQQIKIRI
PSTHLNSKAKIVDVSDEENEGNEGGNDIKGQRDMNAFISHWNKEFDRLNPNPEDNSDFDS
DNDINPLDTLTPAGKYMSSRQLQISSDNLMKKKPIQLSIVGRPNVGKSTLINGLLKENRV
IANDLAGTTRDSVTIQWVHGGRRINLVDTAGVKLGNSIKTEIEQMVKEQVQQSIDYSHVV
VVLIDSMQAFTNHDMMIIKQVLEEGRAVVIAANKWDLVEDKYKKKALKWIEKQLEKGIGQ
AKGIPIAYISAKNGQRVDRIMDEVMRVYEKWNTRVSTALLNKWIHAFQRVQKMPTDEGKT
LKLRFLMQIKTRPPTFFLYVNNRSLIDDTFERFLRNSISNEFGFQGCPMRILVRDNKLQY
ARRGLASLNPTTRAVLHRIETEKNKKKNVTYRRRLAGNKFLYK