Identifiers and Description

Gene Model Identifier

Contig15553.0.g5

Standard Name

EMA1

Aliases

Contig15553_0_g5

Description

Helicase conserved C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000881503.000809166761476e-75nucleic acid helicase, putativ
e
SGDYLR419W2.998863950472602e-38YLR419W SGDID:S000004411, Chr
XII from 958428-962735, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15553.0.g5(coding)
ATGGATTTAAAGCAAGCTCAACAAGTGTTGATGTAAACAAGCATCCCTAAGAAGAGAAAT
TTGGGAGATAGGCATCAGCAAGATAGTGAATCTGAGGGAGAGGATCAATCTCGGGGTGGA
GCGGATCCTTTGGAGGGACCACGAAAAAGGATGAATAATGCCTAGAGTTACTAAGAAATG
GCAGAGGAGACAGCTTAACTCAAATAAATGCAACTGAGTATAGCTGAGACATGCAAGACT
TTGCCAATTGCCAAACACAAAAAGAGAATTATCAGTAAACTTGAACAGAACAGAGTTTTG
GTCATTTCTGGTGACACAGGATGTGGTAAGACAACTTAAGTACCAAAGTACATCCTCGAG
TAAGCAGAGTTTAACAAGAAAGAGTGCAAAATTATTTGTACTTAACCTCGAAGGCTTGCT
GCTGTAAATATTGCTAAAAGAGTTGCTTAAGAACTTGGCGAAAGAGTTGGATTCAAAGTT
GGATACTAAGTTGGTATGTAAAGTAGAAAGACCTAAGGAGTAACAAAGATAACATTCATG
ACAACTGGCATCTTCTTGTAAAGACTTGTAAATAATCCAGACTCTATCAAGAGATGTACT
CATATTATCATGGATGAAGTTCATGAAAGAGATCTTGACATTGATTTTTCACTGGTTGTT
ATCAAGCATCTACTTAACAAGGAAGCAGAGGGCTTTAATTTCAAATTAATTCTCATGTCT
GCTACCTTCAATATCGAGCTGTTCACAAACTACTTTTCTAAAAGCTCAATCAAATCTATA
GAACACATGGCTGTATACGTTGGTGTTGAAGAACAAATGAGAAGACAAGAAGAGGAAAAG
CGTTTAAAACTTGAAAAGCAGTGGGGTCCCTGCAAACAAGAAGACTGGGGAAATTCTGGT
GGTGCTAAAAATAAACAAGACGCTGACATGTAAGATGAAGACCAGTGGATTGAGTCTTCA
GATGCAGTGATGAAGAACTCTATGCCTATTGCTAAGTAAAACGATCCCGCGGACATCATA
GAGATTAATGCCAGACTTTTCGAAGTTAAGGAGTTTTATCTTGATCAAGTAGTAAAGAAT
ATCATGCAGGATGATATGATTGAGAAAACTCCATAAGACAAAGATCTTCTGCTTGAGTCC
TTATAGATCAGTGAAGGTAATAAACCTTAGATCAAAGAGTGCTCAATGAGAGTTGCTTCA
GTTATCATATGTGATGTCATTGAAAAACATAATAGGTTCTAAGATGAAGAAGGTGATAAA
AAGAGTATTCTTGTTTTCTTGCCAGGTCTATTTGAAATATTTGAGTTCATGGATTTCATT
AATGAGAACTATGACCAATAATGGATAAGAAGCAATCTAGAACTTATACCACTTCATTCT
TCGCTTTGTGAAGAGGAGCAAGAAAGAGCTTTCAAGAGCAGTCAAAAGATGGATGGCAAG
AGAAAAGTAATTATATCTACAAATATTGCTGAGAGTTCAATCACTATCCCTGATATCAAG
TACGTCATAGATTTTATGCTAACAAAGGAACTATTCTATGATCCTATGACAAAAAGTGAA
TCTCTCATTTTAAGTTGGGTTTCAAAAGCTTCTTCAAAGCAAAGAGCCGGTAGAGCTGGA
AGAGTTGCAGACGGAATAGTTTTCAGATTATGTCTTGAGAAATTTTTCAAAAATGCCATT
CCCGAATACCCTAAACCAGAAATGCAAAGATGCCCACTTGAAAAGCTAATATTGTAAATC
AAGCTATGGAATAGATATGAAGCTGAAGAGGTACTTGGTAGAGCAATTTAACCTCCAGAG
TTTAGAGACATTTGCAATGCGATAAAGAATCTGTAATAAACTGGAGCTCTTACTATCCCT
CCTCCTTTTGCAAAAACAGATGAAGAGAGGAGATCTAAGATTACCGCACTTGGTAAGATC
TTTGTTAACTTACCATGCGACTTAAAAATTACAAGAATATACCTATTCGGTATGGCTCTT
AAATGCATGTAACAAGCTATTATTATTGGCTGTATTCATCAACAAAGTAGATCAATCTTT
CGTAACAATAGAGTTAGTGATTATGTTAATATGACCAAGTTGCAATGCATCTATGATTAA
AATAGAGATTCAGATTCTATCATGCTTCTAAGAGTATTTTAAGAGTGGGTCTTTAAGTTC
CAACCTCACCTCAAACACAAATAAAACTAGCCCTAAGTTGCAGCTGGGTAGATCCTTCCT
TAGAGGCCAATTTACGATCATAGAAGAATAAGATTTGCTCGACCAAGCCATGCTGAGAGA
TAATGGTGCCGAGACAGAAATTTAGATCTGACTATTCTCAAAGAAGTTGCTACTATGGTC
GAAGAAATCAGACAAAGATTTCAAAAAATGAATATTCCAGAAAAGTGCCTCAATTCTAAG
GTTAAACTTAAGGATGATAACCCAGACGCTGTACTTATCTTGAAACTTTGTATTGGAGGA
GCCTTCTACAATAAGTATGTAAAAGCTGCTTACAAAAACGAAGATGTTTTAGCTAAAATG
GGAAACTCCTCTCTCTTTGTAGGAGATGAGGCCAGAAGAGCCATCATTCTCAATAAAGTA
TCAGAGCATATCTAAGACCACCACTTAAAGCAATATTTTGAAGGTAAATTCAAGGTATAA
GTGATGCAAGTTAAAATCGCACAGGACAAGCCCACAATAATATTCAGCAACGATATCCTC
GACAAGGGTTTCATAAAGGCTTGCTTCAAAATAGGTTTGAAAAACAGAGCATCTCGCTAC
CGAAGACTTCAAGACGATGAGTACGTTGATCAGACTAAGTTTAAGTCTAGGATCTTCGCT
GAAGAAAAAGCAAAAGCTCAGGATGTCTTATACAGCTACCAAGAAATTTAGGAGCAACTT
GAGAATGAAGAACTTAGAAGACCTGTATTTCTTTATGAACTAAGATTTGAGACTCTGAAC
AAAGATGCATATGTTGAATTCGAGAGAGACTCAATAAACAACTTTGCATATGAGCTAGAT
GAGTAGAAGTTAAAGCATGTAACATTCGCATGTTAAGACTACTATGACAAAGCTGGAAGA
TTTATGTGTAGAAACAGTACCAGGCTGCCTGACATTCCAATGGTCGATGCCCTCTACTGT
TTAATATTTGCTCCATAAGTGTAAGTCAAGGCTGATCCTAAGCGCAAACTGTACTTCCAA
AAGATCATTTGCGACGAGGGAGAACTTATTCTAAATCTGACTCATGTACTGACCCACTAA
GACCTTGAGATCATTCAATCTATCCGCACAATGATGAATAAAACCCTGTGCGACGAAGAC
AATTTGAAGCAAGCTCACTTGGCTTAAGTTGATTTTCAGATCAAACGCCTCTTTGGCTTT
TAGAGAATCAGCGTTGACATCTATGAAAAGCTCATGTCTCTTAGAGACGAGGAAGATAAA
ATGAAGCCTCTAAGATAGTTCCTAGGCAAAGAGTCACTGCAAGAGAAGGATGAACTTGAG
AAATTCTTAGCAGGAGAGGGCAACATATTCATGGACACAGAGGTCAATGACAAAAGTGGT
GCAGATATTAAGATTCAGGGAGATGAGAACAGTGGAGATGGCTACGACGAGGTTGATGGC
TGTAGCGATGAAGAGGATGAGTATGGTAATCAACCAACATCAATCTTGAGTCAATCAGAT
TTGTTGAACCGTCAATAGCGCTATGAAAAAGAATGCATGAAAGGCTACTTTTTGCAACCA
ATCTATGTCTAAAAACTGAAGAGAAAGATTCAGTTCTACGAGGGCCTTGTCAAATCCACT
GAGGAAGAATTCAAGAAGAGAGTTACTATCAAGAGAGAAATTATCAAGAGAATGAGACAT
AAGAGCAAGGAACTATCACTCACTGATGTCACTGTGATTTGTGAGAGATGCAGACAAGAT
GTTGCTAAACTGAAGACTTTTGAGTATGTTTAAAATGACCTTCATCACGCTAAATGCGTG
TTTGGATCTCTCAAAAGAGTGGAGATTGAAGAAGCAAAGAACTCTGCTATTTACGAGGAT
GACAAGGAATTCATTGACATTCATTTAGACATCTTTGAGCTGGAAAAACATAGAATACCT
GAAGAGCTATTAAATTAATAGACCACTCAAGGCCAGAACATGTACTACTTCGCATTTTGC
AAATGCATGCACAATCACATTTTAGGCATAATTAAAGACTAGAAGTATTATTTGACTGAC
ATCTCACAAGTGCGCTTGATGTTCCCCAACTCAAAGTATGAGAGCTGGGACTAGAGATGG
TGGAATAAAGGCTACACCGAAGCAATGAGTCTTTAGTAAAAGTGTCTCTTGTCGCGTGCC
TAATAAGGGATCAAGACAGGATCAGAGTAGCAGAGCAGACATATCTAAGATATATACTGC
GAGTTGTGCCACTTGATGCTGAGAGGAGCAGACGATTTCATTGCTCACTGCACTTCCAAC
AAGGATCACAAGGCTCTTGAAGCAAAATTCATGTCCAGCGACTATGACTAGCTACTCAAT
GAAAATGCCAAATATGACATGCCATAGAAGTGA


>Contig15553.0.g5(protein)
MDLKQAQQVLMQTSIPKKRNLGDRHQQDSESEGEDQSRGGADPLEGPRKRMNNAQSYQEM
AEETAQLKQMQLSIAETCKTLPIAKHKKRIISKLEQNRVLVISGDTGCGKTTQVPKYILE
QAEFNKKECKIICTQPRRLAAVNIAKRVAQELGERVGFKVGYQVGMQSRKTQGVTKITFM
TTGIFLQRLVNNPDSIKRCTHIIMDEVHERDLDIDFSLVVIKHLLNKEAEGFNFKLILMS
ATFNIELFTNYFSKSSIKSIEHMAVYVGVEEQMRRQEEEKRLKLEKQWGPCKQEDWGNSG
GAKNKQDADMQDEDQWIESSDAVMKNSMPIAKQNDPADIIEINARLFEVKEFYLDQVVKN
IMQDDMIEKTPQDKDLLLESLQISEGNKPQIKECSMRVASVIICDVIEKHNRFQDEEGDK
KSILVFLPGLFEIFEFMDFINENYDQQWIRSNLELIPLHSSLCEEEQERAFKSSQKMDGK
RKVIISTNIAESSITIPDIKYVIDFMLTKELFYDPMTKSESLILSWVSKASSKQRAGRAG
RVADGIVFRLCLEKFFKNAIPEYPKPEMQRCPLEKLILQIKLWNRYEAEEVLGRAIQPPE
FRDICNAIKNLQQTGALTIPPPFAKTDEERRSKITALGKIFVNLPCDLKITRIYLFGMAL
KCMQQAIIIGCIHQQSRSIFRNNRVSDYVNMTKLQCIYDQNRDSDSIMLLRVFQEWVFKF
QPHLKHKQNQPQVAAGQILPQRPIYDHRRIRFARPSHAERQWCRDRNLDLTILKEVATMV
EEIRQRFQKMNIPEKCLNSKVKLKDDNPDAVLILKLCIGGAFYNKYVKAAYKNEDVLAKM
GNSSLFVGDEARRAIILNKVSEHIQDHHLKQYFEGKFKVQVMQVKIAQDKPTIIFSNDIL
DKGFIKACFKIGLKNRASRYRRLQDDEYVDQTKFKSRIFAEEKAKAQDVLYSYQEIQEQL
ENEELRRPVFLYELRFETLNKDAYVEFERDSINNFAYELDEQKLKHVTFACQDYYDKAGR
FMCRNSTRLPDIPMVDALYCLIFAPQVQVKADPKRKLYFQKIICDEGELILNLTHVLTHQ
DLEIIQSIRTMMNKTLCDEDNLKQAHLAQVDFQIKRLFGFQRISVDIYEKLMSLRDEEDK
MKPLRQFLGKESLQEKDELEKFLAGEGNIFMDTEVNDKSGADIKIQGDENSGDGYDEVDG
CSDEEDEYGNQPTSILSQSDLLNRQQRYEKECMKGYFLQPIYVQKLKRKIQFYEGLVKST
EEEFKKRVTIKREIIKRMRHKSKELSLTDVTVICERCRQDVAKLKTFEYVQNDLHHAKCV
FGSLKRVEIEEAKNSAIYEDDKEFIDIHLDIFELEKHRIPEELLNQQTTQGQNMYYFAFC
KCMHNHILGIIKDQKYYLTDISQVRLMFPNSKYESWDQRWWNKGYTEAMSLQQKCLLSRA
QQGIKTGSEQQSRHIQDIYCELCHLMLRGADDFIAHCTSNKDHKALEAKFMSSDYDQLLN
ENAKYDMPQK