Identifiers and Description

Gene Model Identifier

Contig2840.0.g47

Standard Name

ELP6

Aliases

Contig2840_0_g47

Description

Uncharacterized conserved protein (DUF2348)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam09807 ) Uncharacterized conserved protein (DUF2348)
  • ( pfam10483 ) Histone acetylation protein 2
  • ( pfam12037 ) Domain of unknown function (DUF3523)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005641600.00003998524687536623hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2840.0.g47(coding)
ATGGGATACATAGACTTGTTTTAAAAGCCATTTGATTATAATGTTTTTGACAACTTGCCA
CTCTCTCAGGCAATTCCAAACACATTCACTTCAAAAGTCCCAAAGAAATTGTAGTACCAT
TCTTTCACTTTGGTAGACAGTAACTAAATGATAACCAATAACTTCAAGCAGCTCTTTACT
AAAATTGATAAAGCCATGAAGCCAATGAAAACGGATGGAAAATAGGTTCTAGTTTTGGTA
GATAATCTGAATATATTAATGAATGGATGCTATAGCTCCAGTGAGTTAGATTTCATAGAA
ATTGTCAATGAATTTGTTTCATTGGTTGAGAAAGACTCAAAGACATCAATTGCTCTAGGT
ATCAACAGAGATCTGTTTGACGAAGAAAATACAATGGATATCCAATTTTACAGAGACCTT
AAGAACTCAGTATTCGATTAAATCTATGAGCTCAATCGTAACTTAAGTGGCTATTCAAGA
GATGTGCACGGTCAGTTGAATATAATAACTAATAAACACGCTACAAGTGACTAGCACATT
AAGAATGTTAAGTTTAGACTTACTGAAAATAAAGTTGAAGTGTTTGAGCATTTTGCTATT
TGA


>Contig2840.0.g47(protein)
MGYIDLFQKPFDYNVFDNLPLSQAIPNTFTSKVPKKLQYHSFTLVDSNQMITNNFKQLFT
KIDKAMKPMKTDGKQVLVLVDNLNILMNGCYSSSELDFIEIVNEFVSLVEKDSKTSIALG
INRDLFDEENTMDIQFYRDLKNSVFDQIYELNRNLSGYSRDVHGQLNIITNKHATSDQHI
KNVKFRLTENKVEVFEHFAI