Identifiers and Description

Gene Model Identifier

Contig16809.0.g64

Standard Name

ELP4b

Aliases

Contig16809_0_g64

Description

PAXNEB protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • regulation of transcription by RNA polymerase II (IEA) | GO:0006357

Domains

  • ( pfam05625 ) PAXNEB protein
  • ( pfam05454 ) Dystroglycan (Dystrophin-associated glycoprotein 1)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003018209.99946582325553e-18hypothetical protein
SGDYPL101W0.00008003872323201264ELP4 SGDID:S000006022, Chr XVI
from 360209-361579, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16809.0.g64(coding)
ATGGCTTTTGTCAAGAAGATCAATACTGCTCCTCAGCTTTATAAGAATCAAAAAGGAGTG
CGCACATTTTCTAATCAGCAATACTGCTTGTCTACTGGAAACCCCTCACTTGATTCTTTA
ATTGGTGGTGGTCTCTTAATAGGCTCTATCGTTTTACTTTTGGAAGACTCATTTAGTCAT
TACCATGCTCATCTTGTGAAGAACTATCTGGGAGAGGGCGTCGTAAATGAACATAAATGC
TTTATTGTAGATGCAGATAGCTCATATAGAGAAAGGGAATACTGGCTTAAGTTTCTCCCA
GGTGTAGTCAAACTCAAAAGTGGTAGTAGCAATTCTGGTTCATCAACTGCAAGTCAAAGT
GATGATAATAGCGCATCACCTAACTCTGAGTTAAAATAAGATGAAGAACAGAAATAATCA
AATTCCACTTAAAACCCACAGCTTATAGTGGCATGGCGATATAACACTCTCCTTGAGAAC
AAACAGCATGAAGGGAGTATCTCGCAATAGATTTCTTATAAATTTGATAATTCCAGGGAA
ATGGGAAACACCTACTCTAACTCTATGAGTTCCCAGCTTAAGAAAGATGAAATGACAGTA
TTCATGAAGTATGATACTCAAAATACAAACTATATAGATCTATGGGAATAGATATGTGAA
TAAGTCCAAAATCACTTAGAAAGCGAGAATGATGACAGAATATTCAGGTTTTTAATTCCT
GATTTTCATCTCTTGCTTAAGAATAGCGCTTCTCTTAGTGACGATAAATCTGCAGTTTTG
AAAGAACAAAAGGACATGGTTAGATTCTTAAGAAACTTGAAATCCCTAATTAGAGCCACT
AATGGAGTACTGATGATTTAAGTTGATGAAGATTTACTCTCTAAATTTGTCTACAATAAT
TTATTCTTTGAGGCTGATTTAGTCGTGAAGCTCACTTCATTCTAAGATCACTAAGAGATG
AAGATAGGTGAATATGATGGTACTTTGAGATTTCTAAAACAACCAAAGCTTCATGGACTT
ATCTGTGCTCCACTTGCTGAATTTGATGTTTATGCATTAAAATTGAAGGGAAAATAGGGC
ATAGTGGTCGAAAAGATTCATTTAGAGCCAGAGGAAGATCGCAGTGGCTAAGATGAAAAT
TTGCAATAAAGAGGTAAGAAAGTTCAGACTAAAGGAAATAGCAGTAGTAGTAGCTGTGGG
CATAGCCATGGCAGCACAGCCAGTGTATAGTGTAATCCAACGAAGAGTCACTAATTAGAT
TTTTGA


>Contig16809.0.g64(protein)
MAFVKKINTAPQLYKNQKGVRTFSNQQYCLSTGNPSLDSLIGGGLLIGSIVLLLEDSFSH
YHAHLVKNYLGEGVVNEHKCFIVDADSSYREREYWLKFLPGVVKLKSGSSNSGSSTASQS
DDNSASPNSELKQDEEQKQSNSTQNPQLIVAWRYNTLLENKQHEGSISQQISYKFDNSRE
MGNTYSNSMSSQLKKDEMTVFMKYDTQNTNYIDLWEQICEQVQNHLESENDDRIFRFLIP
DFHLLLKNSASLSDDKSAVLKEQKDMVRFLRNLKSLIRATNGVLMIQVDEDLLSKFVYNN
LFFEADLVVKLTSFQDHQEMKIGEYDGTLRFLKQPKLHGLICAPLAEFDVYALKLKGKQG
IVVEKIHLEPEEDRSGQDENLQQRGKKVQTKGNSSSSSCGHSHGSTASVQCNPTKSHQLD
F