Identifiers and Description

Gene Model Identifier

Contig19993.0.g37

Standard Name

ELP2

Aliases

Contig19993_0_g37

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003122301.0000943968537097e-101conserved hypothetical protein
SGDYGR200C8.000631584680795e-59ELP2 SGDID:S000003432, Chr VII
from 902270-899904, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19993.0.g37(coding)
ATGGAAAACATCAATAAAACCATTCATACTTATACTACTGAAAATGTAGTGCTCTACGAC
CCCCTGATGATCTCAGCCAACACCAATACAGTCCTGAGAGCTTTGGATTTCAATCAAGAA
AATAAACTTGTTGCCTACTCAGCTGCAAACACCATACTCATCATGGACCCATATTACACT
TCTGATTAATCAGACAGCCAGGATTAGCAAAAATAAGTGCCAAGAGTTTTGTTTTCACTC
AAAGGGCATAGTGACAGAGTAAATTCAGTCCAATGGATTAACTCAAATACATTAGTCTCA
ATTTCAAGTGACAAATCCTTGATTATCTGGGGATTTGAAGGCGAAAACGGCAGATTGCCA
GAAAATTGGACATTCAAGAAGATATATCAAAATGCTCATGACACAGACATTAATTACTTG
AGAACTTACAAACATGAATAAAATAATGAATTATATGTCCACAGTATGTGTAGAGACGGC
ACTCTTAAAGTATGGCAAGGTACTTCAAGAGATAACATCCAATATCGTGACTAATTAATA
TTCGGAAAGAATCTATAAGAAGCTCTAGGAGTAGTGGAATTCGGAGAAAAGCATTTAATG
GTAGTATTAGGAGGCTATGATGCCAAAATTCATGTGTACTTGTTCCCAACAATTCAGCAT
CAGAATTCTGAAGCAAAGTCACTCTTTAAGTATAAGGTGTCTCTGCCTGGTCATATGGAT
GCACTTAGAGATTACGATTTCACACCATTTTATGTTGAAAATCAAGTTAGATACCTGGCA
AGTTCGAGTTAAGACAACTATATTAGATTATGGAAAATACAACCTCTTGATAACATCTCA
TAAGATCACGGTGGTCATCTGGATGATGATCTGCAAAAATATGAGAAAGTGCTCTCACTA
TAATCCTTCTGTTTACTTTCCAGCTCATTCGATTTCACTGTGAGTGTGTGGAAATCAGAT
GCAACTGGTCTCTGGTAAGTAGACTCCACTCTTGGAGCTATGGCTGGTAACAAACATGCC
TTCTTCGGTGCTATTTTTATGAAAGACGATCAGCAAATCCTCGCTTACACTTACAACGGA
GGCATGAACAGATGGGACAAGGAGTAAATTCCAGAATCTGACAGCTTCAAGTGGAGTCCA
TAGTTGACTGTGAAGGGACACTTTGGAGAAGTCACTGACATGGATTGGGATTAATATGAA
ACTAATTTGATTACTTGCTCTTAGGATTAGACCACTAGATTGTTTTCGAGATACGGAAAT
GATTTTGGGTGGTTTGAATTCACCAGACCTCAGATTCATGGTTATGACATGAACACTTTA
GCTGTTCTGAGTATGAATTCTAAAGCTGGAAATAATCTCCCATCAAGAATTTTATCTGGT
GGTGATGAGAAAGTTCTTAGACTTTTCGAAGCTCCTTACTCATTCGTAAAGATCTACAAT
TAATTGAACCCCGATTCTAACTAGACTCCACTAAGATATTCAGATTAAAACACCAATGAG
GAAGTTGAAGCTTTGATAGGAGAGGAAGCCGCCAAGAAATAACCACTTGGACTGATGAAC
AAACCCACACTTTTGATGCCAAATTAGAAGTCCAGAGTTGATGAAGAAGATGGTGGTATG
AACGCAGGTGAATTTGATCCAACTAAATATCTTTCTAACACTTAGGATGCCAAGACCAAT
CTTATCTCAGATAAAGATCTCCGTGGTGAGCCTCCTCTTGAAGATATCCTTATGACCAGA
ACTCTCTGGCCTGAACAACAAAAGCTCTACGGACATGCTTTTGAAATTTTCGCAGTGGCT
ACATCTCACAGAGGCGACTGTGCAGCCAGTTCCTGCAAAGCCAAGGAGAAGAAATACGCA
GATATCATCATCTGGGATTTGACTAAGCAGACGACTACCGTCCCATCATGCAGACTTGTA
GCACATAATTTAACTGTAGTACAGTTGGAATTCTCTAAATGTGATTAATATTTGTTGAGT
TGCTCCAGAGACAGGTCTTGGGCAATCTTTAAGAGAGAAAGCGAGGGCAATGGATTGCAG
TTTAGTCTGGTCAGGAGACTTAAAGACGCACATACAAGAATCATATGGGGTGTTTCGTGG
TCTCATGATGATCTTCTATTCGCAACAGCAAGTAGAGAGAAGTAAAAGTCTGTCAAAATT
TTCAAGGGAATTAGCAATGAACAGGAGTTAAACTCTCAAATACAAATTATCAAAGACTCT
AAAATTGGTGATTAAATAAGTGAACTACCCGAAGAACAAAATTAAAACGCCACTGCAATT
AGATTCTTACCTAGTCTTGTTAATGGAGTAAGTAAGTATGCTCTATGTGTTGGTTTGGAA
TCAGGTGAGATCATTATCTGGAAAGCAGATAGTGAAATGAAGTAATGGGCTAGAATATTC
GATTTTCCAGCATACTATCAACATTCGCTTTCCGTAAAGAGAATAAAATTCAATGCTCGT
TATTCTAATCCTAAGAATGATGAATATACTGTAGCTACTTGTGGAGGGGACCATACAGTT
AAGTTATTCAAATTCTAATTGATCAATGGTAATTGA


>Contig19993.0.g37(protein)
MENINKTIHTYTTENVVLYDPLMISANTNTVLRALDFNQENKLVAYSAANTILIMDPYYT
SDQSDSQDQQKQVPRVLFSLKGHSDRVNSVQWINSNTLVSISSDKSLIIWGFEGENGRLP
ENWTFKKIYQNAHDTDINYLRTYKHEQNNELYVHSMCRDGTLKVWQGTSRDNIQYRDQLI
FGKNLQEALGVVEFGEKHLMVVLGGYDAKIHVYLFPTIQHQNSEAKSLFKYKVSLPGHMD
ALRDYDFTPFYVENQVRYLASSSQDNYIRLWKIQPLDNISQDHGGHLDDDLQKYEKVLSL
QSFCLLSSSFDFTVSVWKSDATGLWQVDSTLGAMAGNKHAFFGAIFMKDDQQILAYTYNG
GMNRWDKEQIPESDSFKWSPQLTVKGHFGEVTDMDWDQYETNLITCSQDQTTRLFSRYGN
DFGWFEFTRPQIHGYDMNTLAVLSMNSKAGNNLPSRILSGGDEKVLRLFEAPYSFVKIYN
QLNPDSNQTPLRYSDQNTNEEVEALIGEEAAKKQPLGLMNKPTLLMPNQKSRVDEEDGGM
NAGEFDPTKYLSNTQDAKTNLISDKDLRGEPPLEDILMTRTLWPEQQKLYGHAFEIFAVA
TSHRGDCAASSCKAKEKKYADIIIWDLTKQTTTVPSCRLVAHNLTVVQLEFSKCDQYLLS
CSRDRSWAIFKRESEGNGLQFSLVRRLKDAHTRIIWGVSWSHDDLLFATASREKQKSVKI
FKGISNEQELNSQIQIIKDSKIGDQISELPEEQNQNATAIRFLPSLVNGVSKYALCVGLE
SGEIIIWKADSEMKQWARIFDFPAYYQHSLSVKRIKFNARYSNPKNDEYTVATCGGDHTV
KLFKFQLINGN