Identifiers and Description

Gene Model Identifier

Contig9231.0.g15

Standard Name

ELP1b

Aliases

Contig9231_0_g15

Description

IKI3 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000240506.999124466619517e-162hypothetical protein
SGDYLR384C3.998564387823535e-58IKI3 SGDID:S000004376, Chr XII
from 892900-888851, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9231.0.g15(coding)
ATGTTTGTGTATACAAACAAGCATTAACTTTACACATTCACCTATAATTAGCAAGATAAA
TCTATGGAGTTCCCTACTGAGATAGCATCAAACATAAATCTGAAGAAGCAAACTGATTTC
ACAGATTAAGACCCCACAATAGAACAATCCACCCTTATTTCAATGGACTATATCTAAGAA
TTATAAGGTGTAGTACTTACTTTCTCAAGTGGTTCCATCTACTTATACAGAGTAGCTGAG
AATCAAGTGGAAGAAGCTGGTATCCTACCTGGTGGTATTCTAGCTGCTAAGTGGTCTCCA
AATGAAGAGAATTTCGTGGTTGCAAGTGGCAATGGGAGATTGTTTATGTTTAACACTGAA
TTCGATGTCACTACAGAATGCGATATTGATGATAACGACTTGACATTTTGGAATGTTTCA
CCAGCAGAGTTGGGCAAAGCAGATAAAAGTATCAAAGAAGCTGCTATTTCATGGAGAGGA
GATAGTGCTATATTCGTAGTGAATTATCACATTAATGGAGGTTTCAAATGCTTAACAAGA
GACGCTTAAAACGACATGAGAGTCACTAAAGGTCCTGCAAGAGCAGACGACAAAGCGGTA
TTTTCAGTGAGTGAAAAACCACTAGCAGCATTATAAAAGCCAATATGTTTCATGCCTAAT
GGTAGTTTAGTAGCTGGTTACTCAGTAAGACCCTTACCTGGGTAGCAACAAAAGAAAGAA
ATTGTACTCTGGGAACGTAACGGTCTTAGGCATGGAGAATTTACTCTTCCAGACTAATCA
CAAAGTGTCTAATTTGTTGATTATTCTTCAGACTCTAATCTCCTCTCACTTTACTTAACA
AAAGATCTTGAAAACAATCAAACTTAGCACTCAATCATGATCTTTACTAGAAGCAACTGG
AAATGGTACACTAAACAGCATATTGTCCTGGATAGTCCATTAGCTACTATGAAATGGCTG
TTCAATAAAAAACAGCAAATTGTCATTGTGCAGAAGGATGGTAGAGTTGACTTTATTGAA
TTCGCTTAAAATTATCATACAAGCAGCTCTAACTTCAATCATCATAGCGTTTAAAACTAT
TCTTACACTGCAGTTGTCGACTTCAACAATATTAATCTGACTCCATTAGGCAAGTTCGTG
ATGCCACCTCCTATGTTCGAGAAATAAGTGACCCTTGAGCATGGTATTCCAACCTGCGTC
TATCTGTATGGCCATCTAGCTGGTGCTCTAACAGCATCTTCCCACCTGACTTTATTCAAC
TGCGAAGACCCAAAATCAACCGTGCTTACTCTCAACCTCTCCGCATTTATCAAAGGCAGC
GAAGTGCATAAGTTAATGGTGTTCAAGCAAAACATTAACGATTTAATGAATATGAGTGGG
GTGCAGATTGTTCTGGTTGAGAATATCAAGGATAGTCATAGGGAAGATAGAGTTGTTATA
CTTGAAGTTACCAACAATAAAGAAGCCAGATTAGTGAAAGAATTAAGGGTAGGAAAGATA
TACAGTTCTTGCATTAATGCATCTTTCCATAACAGTGGATTCAATCAATCTTCAGAATTC
CAACAAGAAAACTCTTATTATATCAATGCAGATTCAACAAGTGACAACAAGCCCTCAGGC
ATGTATAATTTCCATTAAGCAGACCAAGACAGCAATTACATACTAGTTTAAACTGTAGAC
AAGAATGTTCATAAATTATATTTGTCGCCAGATTCACATGAAAATGTAGAGCAATAATTC
ACTGTCCCTCATTTGTGCTACAAATTAAACGCTGCTTATATCTCTAATAAAGAAGTCGTT
ATTGGTCTAACTTAAAATCTTAGACTCTACTTAAACGACAAGGTATTCTCAAATGAATGC
ACATCATTTTAATTGAATCAATTCTTCTTGGCTTTCGTAAACACTACTTCAGGGCTTTCA
CATGAGTTATACATTTATGACCTCAACCGTAATTTGCCAAAGCCACTTGGAGGCAATGCA
AGCTCATCCAATGAGCCACCTCAACTTGCTAAATTAGAGGATGATAGTAACTTCAACGTA
AGAGCAGTTGAGAGAGGTTCGAGAATAGTTGTGATTAACGGTACAAAATGCATTCTTCAA
ATGCCAAGAGGCAACTTAGAAGGAATCTCTCCAAGAATCATAATGCTAAACCACGTTATA
GAAGACATTGAAAATCTTGAGTATGGAAAGGCCTTTAGATTACTTAGAACTCATAAAATT
GATATCAACCTCATCTATGATGTTAACCCAGAAAAATTCTTAACTCATATTGAGAAGTTT
GTGAGAGAAGTCAAGCAGGTAGACTACTTAAACCTGTTCATTAACTCGCTTAATGACTAA
GAGAGAGGTAAGGAGCTAGAATTTATGAGGCCATAAAACGAAGAGGACTTAATCAGAAAG
GAGCATGAGAAATACATGCTTTAAGAAATAGGTGGAGGAGTTTAAGAAATCAGAGGCAAG
ATCAATTCAGTTTGTGCTGCACTCAAAGTTGAACTAGAAAAGATCAATCAGGATAATAAA
TACTTGTTACCAATTCTTACAACTTATATAAAGAAACAACCATAAGAACTGAAACAAGTC
TTAAACAAAATCAAGCAAATGCAAAAAGATGAAGATGAGCTAAACTTAGTAAAGAAAGTA
GTCCCACCTCATCTAAACCCAGAAACTATGAAGAGAGAGATCGATCCCACATCTATGAAG
CTTGGTGCTAGAGATGCACTTGAGTATGTATCATGGTTAGTTCAACCAAATAAACTTTTC
GATGTTGCTCTTACAACATATGATTTTGACTTAGTAACCCTGGTTGCAACATAAACACAA
AAGGACCCTAAGGAATATGTACCATACTTGAATGAGCTCAAAGCTATGGATCCAGTTCAT
ATGAAATATTAAGTTCACATTGATTTGAAGCAATACGATAAAGCTGTCAAGAAGCTGTCT
AAAGGTGGAGAGAAATATATTGATGAAGCCCTCTCTATTGTGAAGAAACATAGATTATAC
AAATAAGCTTTGGAATACTACAAATTTGACGCATCTTTAGAAAAGAAAGTAAAATTAGCG
TTCGGTGAGTATCTCGAATCAAGAGGGTACTCTGAGGAAGCTGGTTTCCTATATAATGCA
GCTGGAGAAGTTGAAAAGGGTCTAGATGCTTTCAAGAGGTCTCTAAACATTGATATGTGT
TTCTCATTAGCTTACCAGAACAATTTTACTCAAGAACAGCTTAGAGAGTTGACTGAGGAT
TTAGTCGAGAAACTTTAAACATCTAGCAGATACGAATAAGCAGGAGACTTGATCCTTACT
CTTAAAGATTACAAACCAGAGGAAGCGATAGATTCCTATAATAAAGCCAATAAATTCTCG
AAAGCAATTGAAATTGCTACTAAACATCACAAGCAAGATTTGATTCATTCAATCATCAAG
ACCTCAGTCAAGATTGCGTATGACATTAAGAAGAATTAGTTGCTTCAAGTCCTGTCTGAA
TTTGATAAGCGTTATCTTAGATTGAAGATAGTCTAGCATAACAAAAGACACATCCCACTT
TAACTGTTATAGATGGATGGTGGCAATAATGCCTTCAAGTTTGATGCTGATTAAATGAGT
ATGTCAGGCACTTCTGCACTTTCTGAATCTCAATATTCTTCATCTGGAAGATCAAGTGCA
AGTGGTTTTTCAGAGACTTCAAAGAAAAGTATGAGATAAGGCGCTAAAAAGAAGGCTTAA
AAACAAAAACTAAGAAAGAAGAGAAATGTCAAGGAGGGATCACCTTTTGAAGAAGACTTT
TTGATTGACATGTTGAAAGAAGAGACAAAGATTTTGCAAAGTGACAAGGATGAAGTAAAG
GAAATCATGAAATCTCTTCTTTATTTTGGAATGATTCAAGAGTCTACTGATATTCATGGA
CTGATTGAGAAGCTAATGAAAGCCCAGCATACTTGCAGTTTATTAAAATCAGTCGAATAG
CAATTTTTCATTGAGCGCACTTCTCAAATCGAAGATGAATTCCCAGACCTATTTAGCAAG
AAAAAGAGGGATGAGGACTTCCAGAAGGTACTGGCTGAATGGCAAGATGTCAAATTCTTT
AAGCATTGA


>Contig9231.0.g15(protein)
MFVYTNKHQLYTFTYNQQDKSMEFPTEIASNINLKKQTDFTDQDPTIEQSTLISMDYIQE
LQGVVLTFSSGSIYLYRVAENQVEEAGILPGGILAAKWSPNEENFVVASGNGRLFMFNTE
FDVTTECDIDDNDLTFWNVSPAELGKADKSIKEAAISWRGDSAIFVVNYHINGGFKCLTR
DAQNDMRVTKGPARADDKAVFSVSEKPLAALQKPICFMPNGSLVAGYSVRPLPGQQQKKE
IVLWERNGLRHGEFTLPDQSQSVQFVDYSSDSNLLSLYLTKDLENNQTQHSIMIFTRSNW
KWYTKQHIVLDSPLATMKWLFNKKQQIVIVQKDGRVDFIEFAQNYHTSSSNFNHHSVQNY
SYTAVVDFNNINLTPLGKFVMPPPMFEKQVTLEHGIPTCVYLYGHLAGALTASSHLTLFN
CEDPKSTVLTLNLSAFIKGSEVHKLMVFKQNINDLMNMSGVQIVLVENIKDSHREDRVVI
LEVTNNKEARLVKELRVGKIYSSCINASFHNSGFNQSSEFQQENSYYINADSTSDNKPSG
MYNFHQADQDSNYILVQTVDKNVHKLYLSPDSHENVEQQFTVPHLCYKLNAAYISNKEVV
IGLTQNLRLYLNDKVFSNECTSFQLNQFFLAFVNTTSGLSHELYIYDLNRNLPKPLGGNA
SSSNEPPQLAKLEDDSNFNVRAVERGSRIVVINGTKCILQMPRGNLEGISPRIIMLNHVI
EDIENLEYGKAFRLLRTHKIDINLIYDVNPEKFLTHIEKFVREVKQVDYLNLFINSLNDQ
ERGKELEFMRPQNEEDLIRKEHEKYMLQEIGGGVQEIRGKINSVCAALKVELEKINQDNK
YLLPILTTYIKKQPQELKQVLNKIKQMQKDEDELNLVKKVVPPHLNPETMKREIDPTSMK
LGARDALEYVSWLVQPNKLFDVALTTYDFDLVTLVATQTQKDPKEYVPYLNELKAMDPVH
MKYQVHIDLKQYDKAVKKLSKGGEKYIDEALSIVKKHRLYKQALEYYKFDASLEKKVKLA
FGEYLESRGYSEEAGFLYNAAGEVEKGLDAFKRSLNIDMCFSLAYQNNFTQEQLRELTED
LVEKLQTSSRYEQAGDLILTLKDYKPEEAIDSYNKANKFSKAIEIATKHHKQDLIHSIIK
TSVKIAYDIKKNQLLQVLSEFDKRYLRLKIVQHNKRHIPLQLLQMDGGNNAFKFDADQMS
MSGTSALSESQYSSSGRSSASGFSETSKKSMRQGAKKKAQKQKLRKKRNVKEGSPFEEDF
LIDMLKEETKILQSDKDEVKEIMKSLLYFGMIQESTDIHGLIEKLMKAQHTCSLLKSVEQ
QFFIERTSQIEDEFPDLFSKKKRDEDFQKVLAEWQDVKFFKH