Identifiers and Description

Gene Model Identifier

Contig21547.0.g84

Standard Name

ELP1a

Aliases

Contig21547_0_g84

Description

IKI3 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000240502.998763305092208e-161hypothetical protein
SGDYLR384C3.000969471571755e-58IKI3 SGDID:S000004376, Chr XII
from 892900-888851, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21547.0.g84(coding)
ATGATGTTTGTGTACACAAACAAGCATTAACTTTACACATTCTCCTATAATTAGCAGGAT
AAATCTATGGAATTCCCTACTGAGATAGCATCAAACATAAGTCTGAAGAAGCAAACTGAT
TTCACAGATTAAGACCCCACGATAGAACAATCAACCCTTATTTCAATGGACTATATTCAA
GAATTATAAGGTGTGGTACTCACTTTCTCCAGTGGTTCCATATACTTATACAGAGTAGCA
GAGAATCAAGTTGAAGAAGCTGGTATCCTGCCTGGAGGTATCTTAGCTGCTAAATGGTCT
CCAAATGAAGAGAATTTCGTGATTGCAAGTGGCAATGGGAGGCTGTTTATGTTTAACACA
GAATTTGATGTCACTACAGAATGCGATATTGATGATAACGACTTGACATTCTGGAATGTT
TCACCAGCAGAGTTGGGCAAAGCAGATAAAAGTATCAAAGAAGCTGCTATTTCATGGAGA
GGAGATAGTGCTATATTCGTGGTCAATTATCACATGAATGGAGGATTTAAATGCTTAACA
AGAGACGCTTAAAACGACATGAGAGTCACTAAGGGTCCTGCAAGAGCAGACGATAAAGCA
GTATTTTCAGTGAGTGAAAAACCACTAGCATCACTATAAAAGCCAATATGTTTCATGCCT
AATGGTAGTTTAGTAGCTGGATATTCAGTAAGACCTTTACCAGGCTAACAACAAAAGAAA
GAAATCGTACTGTGGGAACGTAATGGCCTTAGACATGGCGAATTTACTCTTCCAGACTAA
TCTCAAAACGTCCAGTTTGTTGATTATTCTTCTGACTCAAATCTCCTCTCACTTTACTTA
ACAAAAGATCTCGAAAACAATCAGACTTAGCACTCAATCATGATCTTTACTAGAAGCAAC
TGGAAATGGTACACTAAACAACATATTGTTTTGGATAGTCCACTAGCTACTATGAAATGG
CTGTTCAATAAAAAATAGTAAATTGTCATTGTTCAGAAGGATGGCAGAGTTGACTTTATT
GAATTCGCTTAAAATTATCATACAAGCAGCTCTAACTTCAATCATCATAGCGTTTAAAAC
TATTCTTACACTGCAGTTGTCGACTTCAACAATATTAATCTGACTCCATTAGGCAAGTTC
GTGATGCCACCTCCTATGTTCGAGAAATAAGTGACCCTTGAGCATGGTATTCCAACCTGC
GTCTATCTGTATGGCCATCTAGCTGGTGCTCTAACAGCATCTTCCCACCTGACTTTATTC
AACTGCGAAGACCCAAAATCAACCGTGCTTACTCTCAACCTCTCCGCATTTATCAAAGGC
AGCGAAGTGCATAAGTTAATGGTGTTCAAGCAAAACATTAACGATTTAATGAATATGAGT
GGGGTGCAGATTGTTCTGGTTGAGAATATCAAGGATAGTCATAGGGAAGATAGAGTTGTT
ATACTTGAAGTTACCAACAATAAAGAAGCAAGATTAGTGAAAGAATTAAGAGTAGGAAAG
ATATACAGCTCTTGCATTAATGCATCTTTCCATAACAGTGGATTCAATCAATCTTCAGAA
TTCCAACAAGAAAACTCTTATTATATCAATGCAGATTCAACAAGTGACAACAAGCCCTCA
GGCATGTATAATTTCCATTAAGCAGACCAAGACAGCAATTACATACTAGTTTAAACTGTA
GACAAGAATGTTCATAAACTTTATTTGTCGCCTGATTCACATGAAAATGTAGAGCAATAA
TTCACAGTCCCTCATTTGTGTTACAAATTAAACGCTGCTTATATCTCTAATAAAGAAGTC
GTCATTGGTCTCACTTAAAATCTCAGACTCTACTTAAACGACAAGGTATTCTCTAATGAA
TGTACATCATTTTAATTGAATCAATTCTTCCTGGCTTTCGTGAACACTACTTCAGGGCTT
TCACATGAATTATACATTTATGACCTCAACCGTAATTTGCCAAAGCCACTTGGAGGCAAT
GCAAGCTCATCCAATGAGCCACCTCAACTTGCTAAATTAGAGGATGACAGTAACTTCAAT
GTTAGAGCAGTTGAGAGAGGTTCAAGAATAGTTGTAATTAACGGTACAAAATGCATCCTT
CAAATGCCAAGAGGCAACTTAGAGGGAATCTCTCCAAGAATCATAATGCTAAACCACGTT
ATAGAAGACATTGAAAATCTTGAGTATGGAAAGGCCTTTAGATTACTTAGAACTCATAAA
ATTGATATCAACCTCATCTATGATGTTAACCCAGAAAAATTCTTAACTCATATTGAGAAG
TTTGTGAGAGAAGTCAAGCAGGTAGACTACTTAAACCTGTTCATTAACTCGCTTAATGAC
TAAGAGAGAGGTAAGGAGCTAGAATTTATGAGGCCATAAAACGAAGAGGACTTAATCAGA
AAGGAGCATGAGAAATACATGCTTTAAGAAATAGGTGGAGGAGTTTAAGAAATCAGAGGC
AAGATCAATTCAGTTTGTGCTGCACTCAAAGTTGAACTAGAAAAGATCAATCAGGATAAT
AAATACTTGTTACCAATTCTTACAACTTATATAAAGAAACAACCATAAGAACTGAAACAA
GTCTTAAACAAAATCAAGCAAATGCAAAAAGATGAAGATGAGCTAAACTTAGTAAAGAAA
GTAGTCCCACCTCATCTAAACCCAGAAACTATGAAGAGAGAGATCGATCCCACATCTATG
AAGCTTGGTGCTAGAGATGCACTTGAGTATGTATCATGGTTAGTTCAACCAAATAAACTT
TTCGATGTTGCTCTTACAACATATGATTTTGACTTAGTAACCCTGGTTGCAACATAAACA
CAAAAGGACCCTAAGGAATATGTACCATACTTGAATGAGCTCAAAGCTATGGATCCAGTT
CATATGAAATATTAAGTTCACATTGATTTGAAGCAATACGATAAAGCTGTCAAGAAGCTG
TCTAAAGGTGGAGAGAAATATATTGATGAAGCCCTCTCTATTGTGAAGAAACATAGATTA
TACAAATAAGCTTTGGAATACTACAAATTTGACGCATCTTTAGAAAAGAAAGTAAAATTA
GCGTTCGGTGAGTATCTCGAATCAAGAGGGTACTCTGAGGAAGCTGGTTTCCTATATAAT
GCAGCTGGAGAAGTTGAAAAGGGTCTAGATGCTTTCAAGAGGTCTCTAAACATTGATATG
TGTTTCTCATTAGCTTACCAGAACAATTTTACTCAAGAACAGCTTAGAGAGTTGACTGAG
GATTTAGTCGAGAAACTTTAAACATCTAGCAGATACGAATAAGCAGGAGACTTGATCCTT
ACTCTTAAAGATTACAAACCAGAGGAAGCGATAGATTCCTATAATAAAGCCAATAAATTC
TCGAAAGCAATTGAAATTGCTACTAAACATCACAAGCAAGATTTGATTCATTCAATCATC
AAGACCTCAGTCAAGATTGCGTATGACATTAAGAAGAATTAGTTGCTTCAAGTCCTGTCT
GAATTTGATAAGCGTTATCTTAGATTGAAGATAGTCTAGCATAACAAAAGACACATCCCA
CTTTAACTGTTATAGATGGATGGTGGCAATAATGCCTTCAAGTTTGATGCTGATTAAATG
AGTATGTCAGGCACTTCTGCACTTTCTGAATCTCAATATTCTTCATCTGGAAGATCAAGT
GCAAGTGGTTTTTCAGAGACTTCAAAGAAAAGTATGAGATAAGGCGCTAAAAAGAAGGCT
TAAAAACAAAAACTAAGAAAGAAGAGAAATGTCAAGGAGGGATCACCTTTTGAAGAAGAC
TTTTTGATTGACATGTTGAAAGAAGAGACAAAGATTTTGCAAAGTGACAAGGATGAAGTA
AAGGAAATCATGAAATCTCTTCTTTATTTTGGAATGATTCAAGAGTCTACTGATATTCAT
GGACTGATTGAGAAGCTAATGAAAGCCCAGCATACTTGCAGTTTATTAAAATCAGTCGAA
TAGCAATTTTTCATTGAGCGCACTTCTCAAATCGAAGATGAATTCCCAGACCTATTTAGC
AAGAAAAAGAGGGATGAGGACTTCCAGAAGGTACTGGCTGAATGGCAAGATGTCAAATTC
TTTAAGCATTGA


>Contig21547.0.g84(protein)
MMFVYTNKHQLYTFSYNQQDKSMEFPTEIASNISLKKQTDFTDQDPTIEQSTLISMDYIQ
ELQGVVLTFSSGSIYLYRVAENQVEEAGILPGGILAAKWSPNEENFVIASGNGRLFMFNT
EFDVTTECDIDDNDLTFWNVSPAELGKADKSIKEAAISWRGDSAIFVVNYHMNGGFKCLT
RDAQNDMRVTKGPARADDKAVFSVSEKPLASLQKPICFMPNGSLVAGYSVRPLPGQQQKK
EIVLWERNGLRHGEFTLPDQSQNVQFVDYSSDSNLLSLYLTKDLENNQTQHSIMIFTRSN
WKWYTKQHIVLDSPLATMKWLFNKKQQIVIVQKDGRVDFIEFAQNYHTSSSNFNHHSVQN
YSYTAVVDFNNINLTPLGKFVMPPPMFEKQVTLEHGIPTCVYLYGHLAGALTASSHLTLF
NCEDPKSTVLTLNLSAFIKGSEVHKLMVFKQNINDLMNMSGVQIVLVENIKDSHREDRVV
ILEVTNNKEARLVKELRVGKIYSSCINASFHNSGFNQSSEFQQENSYYINADSTSDNKPS
GMYNFHQADQDSNYILVQTVDKNVHKLYLSPDSHENVEQQFTVPHLCYKLNAAYISNKEV
VIGLTQNLRLYLNDKVFSNECTSFQLNQFFLAFVNTTSGLSHELYIYDLNRNLPKPLGGN
ASSSNEPPQLAKLEDDSNFNVRAVERGSRIVVINGTKCILQMPRGNLEGISPRIIMLNHV
IEDIENLEYGKAFRLLRTHKIDINLIYDVNPEKFLTHIEKFVREVKQVDYLNLFINSLND
QERGKELEFMRPQNEEDLIRKEHEKYMLQEIGGGVQEIRGKINSVCAALKVELEKINQDN
KYLLPILTTYIKKQPQELKQVLNKIKQMQKDEDELNLVKKVVPPHLNPETMKREIDPTSM
KLGARDALEYVSWLVQPNKLFDVALTTYDFDLVTLVATQTQKDPKEYVPYLNELKAMDPV
HMKYQVHIDLKQYDKAVKKLSKGGEKYIDEALSIVKKHRLYKQALEYYKFDASLEKKVKL
AFGEYLESRGYSEEAGFLYNAAGEVEKGLDAFKRSLNIDMCFSLAYQNNFTQEQLRELTE
DLVEKLQTSSRYEQAGDLILTLKDYKPEEAIDSYNKANKFSKAIEIATKHHKQDLIHSII
KTSVKIAYDIKKNQLLQVLSEFDKRYLRLKIVQHNKRHIPLQLLQMDGGNNAFKFDADQM
SMSGTSALSESQYSSSGRSSASGFSETSKKSMRQGAKKKAQKQKLRKKRNVKEGSPFEED
FLIDMLKEETKILQSDKDEVKEIMKSLLYFGMIQESTDIHGLIEKLMKAQHTCSLLKSVE
QQFFIERTSQIEDEFPDLFSKKKRDEDFQKVLAEWQDVKFFKH