Identifiers and Description

Gene Model Identifier

Contig364.0.g45

Standard Name

ELGI1f

Aliases

Contig364_0_g45

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • modulation by virus of host morphology or physiology (IEA) | GO:0019048
  • negative regulation of gene silencing by RNA (IEA) | GO:0060967

Domains

  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13639 ) Ring finger domain
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam01524 ) Geminivirus V1 protein
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001284209.997764199084386e-16TRAF-type zinc finger family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig364.0.g45(coding)
ATGAATCTTTCCAATGATATAATCCCAGATTTACAACCATCTTTTATAAGTGTTCTACAA
AATGATAAGGATAGACATAAAGTATCTCACGAAATGGTAGTGTTCCCCCCATAGCCATTA
GATGAACTTAAAAGAAGCATGACTACTTGTTAAATTTGCTTCATGATTGTGAATGATCCT
CAAGAATGCAAAAAATGTCAGAATTAGTTCTGTAAGGACTGTATTCAAGAATGGATTTAT
GCTTAAAAGAGAAAGCATAGCTAAAAGATGTGTCCCTTTCGTTGCAATACTAAAGAATTT
AAGCCCTCTCATAAATTTGTTAAAGAAGTCTTAAGTGAATACAAAGTGAGATGCCTTAAT
CACATCCTCGGTTGTGAAGATTTATTAGCAATAGCAAATTTAAAAAATCATTTAAACACT
GAATGTATGTTTGATTAAGTGTATTGCGATAAGAGACCAAAATGCAAAGAGATAATGATG
AGAAAGGATATGATAGATCATATTAAAATTTGCCAATATGTTCAAGAAAAATGCCAATAT
TGCCACACAATATGGATCGAGAGAAGATTGATGTAGAATCACCATTTGTTTGAATGCAAA
GGAAATCTTCATCCCTGCTCTTATTAATATCTAAAGTAATAAGTTGAGAAATATAAAAAT
AAGAGTAAATTGAGGAAAAAAACAATCAAATTACAAGAATCAGATTTGAAAATAATGGAT
GACTGTTAGAGCTGTAAAGATAAAATTGCTCAAAAGTAGCTAAAATAAGCTCAAAATGTT
ACTTAAATGCTGAGATCTGCTTTCATTAATATTGGTAAAATGACTCTTTAGATTTACACA
AATTCTACTTCTCAAAATCAGATGCCCTCAAATTCCCTTGTAAAATCTAGGAATGCCTAC
CTCTAATCAATCTTCTTGAAATCTTTTGATAATTTACTATCAATTACATATGAATGCAAA
CTGAAAAAAAGTAAAATATACAACAAGTATTTCAAATAAAGGCTTAATGGGTAGGATAGA
AAATAATTAGAATGGGAAAAGGAGAAAGAGTAGTAAGCTCATTAAAACGGATGGCTTTAT
CTTGGTGATTTATTTGCTGATGAAGAGGAGCAAAAATAGCAATAAGAATAAGTCAATCAA
TCAATTCAACAAAATAATCAACGAGTTTAATAGTAATAAAATCATGCAAATTAAGAAGAA
AATTAAAATATAAGCGATTATGAAGAAAATCCTATTGAAAATTTATTGTGGTTTGATGAT
TATTGA


>Contig364.0.g45(protein)
MNLSNDIIPDLQPSFISVLQNDKDRHKVSHEMVVFPPQPLDELKRSMTTCQICFMIVNDP
QECKKCQNQFCKDCIQEWIYAQKRKHSQKMCPFRCNTKEFKPSHKFVKEVLSEYKVRCLN
HILGCEDLLAIANLKNHLNTECMFDQVYCDKRPKCKEIMMRKDMIDHIKICQYVQEKCQY
CHTIWIERRLMQNHHLFECKGNLHPCSYQYLKQQVEKYKNKSKLRKKTIKLQESDLKIMD
DCQSCKDKIAQKQLKQAQNVTQMLRSAFINIGKMTLQIYTNSTSQNQMPSNSLVKSRNAY
LQSIFLKSFDNLLSITYECKLKKSKIYNKYFKQRLNGQDRKQLEWEKEKEQQAHQNGWLY
LGDLFADEEEQKQQQEQVNQSIQQNNQRVQQQQNHANQEENQNISDYEENPIENLLWFDD
Y