Identifiers and Description

Gene Model Identifier

Contig17395.0.g67

Standard Name

ELGI1d

Aliases

Contig17395_0_g67

Description

TRAF-type zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008770703.9983110956465888e-22TRAF-type zinc finger family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17395.0.g67(coding)
ATGTTATCATGTGATAGAGTGGTCAATTAAGCCTCTTTAAAAGAAGAATTAAAATGTAGA
ATTTGTTTTGGAGTGTTAAGGGATCCCCAAGAATGCAAAAACTGTGAAAATTGCTTTTGC
TTGAGTTGCCTTGAAGAGTGGTTCAAATCTAATTATATATGCCCTATGAAATGCTCCTAA
GAACCAGATTTCAAATCAAAGGCTCATAAGATTATCAGGAATATGCTCAGTGAATTAGTG
ATATGCTGCTAATTCCAAGAGTTTGGATGCTAAGCATAGATTTCTTATGATAAATTAGAA
GATCATGAGAACTTTGAGTGTGAGTTTGAGATGCTAGAATGCAATGCAAAAGAATAAGGT
TGTGATGTGAGACTTAAACGCAAAGAAATGACAACACATAAAATAATTTGCACCTACATG
CCAACATAATGTGACTTTTGCAAGCTCATGGTAAAACGTAAAGAAATTTAAGCACATTGG
ATGCATTGCGAAGAAGCAGAATTATCTTGTGAATTTTGTCATAGTGTGGTTAAAAGAAAA
AGCTACCTGATTCATGTGAACGCTCTTTGTGAAGAATTTGTTATGAACTGCGGGAGATGC
TCTGGTACATATAAGAGAAAATTCAGAGCGTTTCATGATTGCATTAGACATTTATAAAAC
TGCTAAAAGACTATGAGTGAAGACATCATAGTTTTAAAAGAGATGCTTATCACTAAAGAT
AAGAAGATAAAAGACCTTGAAAACAAGATGTTCCTTGAAATTAGAGAAATGAAACTTAAG
ATAGATCAAATATAGTCACAGGAATTTCCAAATAAATAAGACAATTTCATAACCCAAAAC
CATAACTAAAGTTCAAGTAGTTAGCTCGAGTTGGTAGACAAATCATTTTCATGGGATACT
AATACTACCCTGAATTTTATTTGCAATAAAGAAGCCTTAAATACTGCCGATTTAAATCTA
GAAAGGATTTTAAATGTCCCTTTCTAACAATCATTTGATGAGGTATTTCTGGCATTAATT
CGATAATAAAATTTATATGATGCAAGGCATCTATACCAACTGACAATAAATTTGCAATCA
GATAATTTACAGACTCAAGTTCTCCAACCAGTTTATTTGTTCATTGGTGTCGTATAATAA
GATTTATACTCTAAATTGCAATCTCAAACTTACTCTTTTGACAGTATTTATTAGCAACTC
GCAGAGAAATGTTTATTCTAGCAAGTGTTTAGCCAGCAATTTTAGCAATAATTTAAGTTT
AAGGTTAGAGCTAAAACTAAGAAAATTTAATAAAGTAATATTGAAGAGAGTAAGGATTAA
GTTTGTGATATGCAGACTATTGAAATTGAAGATACAAATAAAAATTCGAAGCTATAGTTT
TAATACCCCTCAATTGACCCAGTATTGGTTTTCGGAATTTATAGTAAAACTAATTTAGAA
CTCAGCTATTTCAAAGACATTCAAGTTATTCTCAACTGA


>Contig17395.0.g67(protein)
MLSCDRVVNQASLKEELKCRICFGVLRDPQECKNCENCFCLSCLEEWFKSNYICPMKCSQ
EPDFKSKAHKIIRNMLSELVICCQFQEFGCQAQISYDKLEDHENFECEFEMLECNAKEQG
CDVRLKRKEMTTHKIICTYMPTQCDFCKLMVKRKEIQAHWMHCEEAELSCEFCHSVVKRK
SYLIHVNALCEEFVMNCGRCSGTYKRKFRAFHDCIRHLQNCQKTMSEDIIVLKEMLITKD
KKIKDLENKMFLEIREMKLKIDQIQSQEFPNKQDNFITQNHNQSSSSQLELVDKSFSWDT
NTTLNFICNKEALNTADLNLERILNVPFQQSFDEVFLALIRQQNLYDARHLYQLTINLQS
DNLQTQVLQPVYLFIGVVQQDLYSKLQSQTYSFDSIYQQLAEKCLFQQVFSQQFQQQFKF
KVRAKTKKIQQSNIEESKDQVCDMQTIEIEDTNKNSKLQFQYPSIDPVLVFGIYSKTNLE
LSYFKDIQVILN