Identifiers and Description

Gene Model Identifier

Contig4382.0.g52

Standard Name

ELGI1c

Aliases

Contig4382_0_g52

Description

Ring finger domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13639 ) Ring finger domain
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam05883 ) Baculovirus U-box/Ring-like domain
  • ( pfam01980 ) Uncharacterised protein family UPF0066
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13442 ) Cytochrome C oxidase, cbb3-type, subunit III
  • ( pfam12678 ) RING-H2 zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003708600.000000019990673443141236conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4382.0.g52(coding)
ATGGTAGAAGATTATGTCTTGTCAGATAGTCGAATAGTAAGCAACGATGAAAATAAAGAT
ATCAAGGATTATATCTTATGTGGAATCTGTTACCAAGTAGTTACAGAAAATCGTGGCCCT
GTAGAATGTAATTCTTGTCATAATTAGCTTTTCTGTACTCAATGTATCCAAGGTTGGGCT
AATTCTAACTCAACATGCCCCTATTGCCACGCAGCAAACGCCAAATATGTAGAGATTTCA
CCACTTCTATTAAATATGATAAAAGAAATCAAATATCATTGCAAATATAAGGAGAGTGAG
GGCTGTACATTTACTGATACGGCCTAGGGACTTCCTAAACATGAATATGAATGTGTGTTT
GGATTGAATAGACAGTCTATGAGACCACCGAAAGTAATTAATTGCCAGTTTTGTCATAAA
CTTGCATCAAAGCAACCTCCAAGTTTATAATTTCATGAGCACGGTTAATATCAGCCTTTA
GGGGATGACGATGAGGATCATGTTTGTGATTTTATTATGAATTTTTGGTGCTTTGATCAT
AAATAATTGGGACTAAAATATTAGAACTCTAGAATAGCAAATATAGAGGAGACTCAAAGA
TACTTCGACTTGTTCAATCTCCTACTTATGAAAATATCCCTCGTAACTTGTTAAGTTTAC
TAAATAAATTCCAGATTTACTGCAAAAATTGAGAGCAAGGCTGCTCAGAAATATTGGCTT
ATGAAAATGTAGAGAAACATGAAAGCACCTGTTTAAATTAGAATTAAGAAGCACTACTTG
GTTTAGATGGACAAAATAACGACGAGCCGTCACTCTTGGATCACTTATATGTTCGACCAT
CTAGAGGGTACTGCAGAAATATTAGATATGATTCAAAATAAAACATATCAAACTGTCCAA
TAGGCTTAACTATACCCCTGA


>Contig4382.0.g52(protein)
MVEDYVLSDSRIVSNDENKDIKDYILCGICYQVVTENRGPVECNSCHNQLFCTQCIQGWA
NSNSTCPYCHAANAKYVEISPLLLNMIKEIKYHCKYKESEGCTFTDTAQGLPKHEYECVF
GLNRQSMRPPKVINCQFCHKLASKQPPSLQFHEHGQYQPLGDDDEDHVCDFIMNFWCFDH
KQLGLKYQNSRIANIEETQRYFDLFNLLLMKISLVTCQVYQINSRFTAKIESKAAQKYWL
MKMQRNMKAPVQIRIKKHYLVQMDKITTSRHSWITYMFDHLEGTAEILDMIQNKTYQTVQ
QAQLYP