Identifiers and Description

Gene Model Identifier

Contig21491.0.g105

Standard Name

ELGI1b

Aliases

Contig21491_0_g105

Description

Zinc finger, ZZ type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003164004.0002685161515803e-16TRAF-type zinc finger family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21491.0.g105(coding)
ATGGGAATCGAACTTGATTTAGTCCTTTTGAAAGAAGGGGAAGAAGTTAACAAACATCTA
CTTTGTGGAATTTGTTTCATGATATTGGAAGAGCCAGTGCAATGTTCAAGTTGTCAAGCA
TGCTTTTGTAAGGAATGCATCGAAATATGGAAGTAAAGAAAGCACTAATGTCCAAATAGA
TGTGATGGGTACCTAAAAACAGAAAATGTTCACAGAATAATAAGGAACATGGTTGAGGAC
TTGACCATAATGTGCAAATACAATTAAGAAGGTTGTGATAAGTTATTTAAAGTTGGAGAA
TTAAAGCATCACTCAGAAATTTGCCCCTACCATCCACTTTCTTGCTAGAATTCTGGTTGT
GATTATGTGGCAGCTAGACATCTGATGAAAGACCACCATCCTTAGTGCGAATACAAAACA
GAGATATGCTAGAAGGGCTGTCAAAAGGTTTTGAAATTGAGTGAAATTCCTAATCATAAT
TGCATTGCTTCACTAACCGCAGAAGTCAAAATGTTGAGAGCTAATGAAGAATTACTTAGA
GAAGACGTCGTTAAGCAACAAGAACTTATCAAAGAATTATCAGGCAGTTTGTAATTGAAG
AATTATGTGCACGAAAACATTTCTTGCTATGAGTGTATGATGGATCCAATAAAGACAGAC
AGATTTAAGTGCCAATAATGCCAAGATTACGACATCTGCCTGTATTGCTACTGTAGAGGC
AGTCACCCAAAGACCCATAAATTCACTGTTCTAGGTCCTCTAGGGGTGGTTATAGTAAAA
GAAAGCGATGTGGCATATTTCCAAAAGAGAGGGTAGATCTTGAAGAAGGAAATATTCTTC
AAGAACATGGGCGAAGAACTAGAGCTTACTGTCAGGCCTTATAATAACGCAGTCTTCGCC
AATGAAATGCAATAATAACCGGTACATTTATCTGAGTTCTAATCTACTTATATACAAGTA
CCTTAGGGTGAATGTGGGAGTGTATACTTTCACTTCATTGTGTAGAACGATGATGGAAAT
TACTCAGCTAGGTTTAGATTCTACTGTAGGAAGAGGAATGAGTACTTTGGAAATAATATA
ATCATAAACTATCAAGTATCTGGAGTTAGCATACAACAATGA


>Contig21491.0.g105(protein)
MGIELDLVLLKEGEEVNKHLLCGICFMILEEPVQCSSCQACFCKECIEIWKQRKHQCPNR
CDGYLKTENVHRIIRNMVEDLTIMCKYNQEGCDKLFKVGELKHHSEICPYHPLSCQNSGC
DYVAARHLMKDHHPQCEYKTEICQKGCQKVLKLSEIPNHNCIASLTAEVKMLRANEELLR
EDVVKQQELIKELSGSLQLKNYVHENISCYECMMDPIKTDRFKCQQCQDYDICLYCYCRG
SHPKTHKFTVLGPLGVVIVKESDVAYFQKRGQILKKEIFFKNMGEELELTVRPYNNAVFA
NEMQQQPVHLSEFQSTYIQVPQGECGSVYFHFIVQNDDGNYSARFRFYCRKRNEYFGNNI
IINYQVSGVSIQQ