Identifiers and Description

Gene Model Identifier

Contig19592.0.g15

Standard Name

ELF1b

Aliases

Contig19592_0_g15

Description

Transcription elongation factor Elf1 like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL160W1.0004572433669413e-23ELF1 SGDID:S000001643, Chr XI
from 153269-153706, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19592.0.g15(coding)
ATGGGCAAGAGAAAGCAGAAGAAGATGAAGGCAGCCAAGAAACTCACCAAGAAACTAGAG
ACTGTTTTTGACTGTCCCTTTTGCAACCACAGCCAGTGCGTCGAGATCAAGCTAGTGAGG
GATAAGCAGATTGGGTACCTGAGCTGTAGAGTTTGCAACGTGAACTACCAATCCAAGATT
CACCATTTGTCTGCTGCAGTAGATGTGTACTGTGCCTGGATCGATGACTGCCACAAGCTC
AACACAGGGAGAGTTGCTGATGAACTGGATGATTTCTGA


>Contig19592.0.g15(protein)
MGKRKQKKMKAAKKLTKKLETVFDCPFCNHSQCVEIKLVRDKQIGYLSCRVCNVNYQSKI
HHLSAAVDVYCAWIDDCHKLNTGRVADELDDF