Identifiers and Description

Gene Model Identifier

Contig14993.0.g85

Standard Name

EIF5B

Aliases

Contig14993_0_g85

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007720609.997093137033517e-262Elongation factor Tu GTP bindi
ng domain conta...
SGDYAL035W9.997093137033517e-262FUN12 SGDID:S000000033, Chr I
from 76427-79435, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14993.0.g85(coding)
ATGAGTTCAGAACAAGAGCCAGTAGATATTACTGCTGATGTTGGAGCTGATGGAAAGCAA
GCTCTATCAAAAGCACAAAAGAAGAAAGCCAAGGCAAAGGCTAAGGATGTTAAGGATGTT
CCAGCAGAAGAAAATGGCGCTGAAGAAGAAAAGGAAGAAAAAGCTGGTGGAGCAAAAGCC
AAAAAGGGAAAGAAGGGAGCAGCTGGTGGCAGATCAGCCATTGCTGCTTTGGCTTAACAA
AGAATCAAGGAGAAGGAAGAGCTTGAGAGAATCCAAAGAGAGGAGGATGAACGCATCAGA
TTGGAAGAAGAAGCTGCTGAGAAAATCAGATTAGAGGAGGAGAATATTCGCAAAGAACAG
GAGGAGCGCAGAAGGAAAGAAAAGAGAGACAAAATTGAGGAATTAAAGAGACAAGGCAAA
TATCTCACCAAAGCACAAAAGCAGCAGAAGGAAGATGCTGAAAGAAGAAGAAATGCTTTG
ATAGCTGCAGGAATGGTTAAGCCTGAAGACCCTATCGAGGATGAAGAACCAGAGACTGGC
AAAAAGCACAGTACTCTTGTCAGAAATAAAAAGAAGAAGGACAAGAAAAAGGACTTACCA
ACTGATGCATAAACTAACATTAATGATACCACACTAGACACTACTGCTAATACTACAATT
TCCTCCAGTGTTGGAGTAAATGGAAAGGCATCAGTAAACCATGAAGAAGCCAAAGAATCT
GTCTAAATCAACACAGCAACAAATGATCAAGAAGAAGAGGAAGATGTGATTGATGATTGG
GAGAACGCTGATATTGATGATATGACTAACAAAATTTAACAGAAAAGTGCTAAGTAATCA
TCCCTTCAAGGAGGCAAAGCAATCAGAGAAGATGAGGAAGAAGATAAATTACAACAAGAA
GCTCAATAAGAGAAGCTGTAAAAAACTATTCAAGCTCAAGCTAAGGCAAAGAAACAAGTA
GTTGCTGAGGAAACTAAAGGAGGAGATATGTTTGATAGAGCAGCTGAAAGCACTGACAAA
AGAGATAAGAGACTAGCTGAAATAAGAGCTAAGAGAGAAGAAAGAGATTAAGCCAAAATG
GATAGATTGAAGAGAAAGAAGGAAATGCAATAAAAACTTAGATGCCCAATTATCTGTATT
CTTGGTCACGTCGATACAGGCAAAACCTTAATTCTTGATAAACTTCGTCGCACTAATGTT
CAAGCTGGTGAAGCTGGAGGTATTACACAACAAATTGGAGCAACCTATTTCCCAGAAATT
GCTCTTAGAGAGCATCAACAAAGAATCAAAGGAAGAATAGATCTTGAATTACAAATTCCA
GGATTCTAAATCATTGATACTCCAGGGCATGAGTCTTTCACAAATTTAAGATCTAGAGGT
TCAAATCTTTGCGATATTGCAATCTTGGTTGTTGATATCATGCATGGATTGGAAAAGTAA
ACCCTCGAATCACTTCAACTTCTTCTTAATAAAAAAACACCTTTCATTGTAGCCCTTAAC
AAAATTGATCGTATATATGAATGGAAATCAGAGCCCTATAGAAATACTAGAGATTCTATT
GAGAGCCAAGCAGCCCATTGTCAAGCTGAGTTCAAGGAAAGATTGCAAAAGACAATTCTT
GAATTTTCAGAACAAGGACTTAACTCTGCTCTTTATTGGGAGAACCCCGATCCTACTGAA
TACATCAGTATGGTACCAACTAGTGCAATTACTGGAGAAGGTTTACCAGATTTAATGATC
TATATCTCCTAATTGTGTTAAACTATGTACAGAGAGAATCTTAGAGAAAAGGATGAATTT
GAGTGCTCAGTATTAGAAGTAAAAGTCATTGAAGGTCTGGGTACAACTATTGATGTTATT
CTAGTTAATGGTATTCTTAATGTCGGTGATACAATTGTGTTGTCTGGTTTCAATGGGCCT
ATAGTAAGCAACATTAGAGCCTTGTTGACTCCTCAACCTATGAGAGAAATGAGAGTCAAG
GGAGACTATATTCATCATCAGAGCATTCAAGGATCCATGGGTATTAAAATCTCAGCAAAT
GGTCTAGAAAATGCTATTGCTGGTTCTGAGCTTTTCAGAGCAACTAATGAGGAGGAAATT
GAAACTTATAAGGCATAAATTCAAGACGATCTTGTTGATATCATGGACAAATATGTTGAT
AAAACAGCATCAGGAGTGTGTGTACAAGCCAGTACTCTTGGATCTCTAGAAGCTCTATTA
GAATTCTTAAAGACTATGAAGATCCCAGTTACTGCAATCAATATTGGTCCAGTTCACAAA
AAGGATATCTTGAAAGCTATGAAATCAATTGCTGGAGAGTTTAAGGAAAGAGAATTCGCC
ACTGTCCTGGCATTCGATGTTAAGATTACTCCCGAGGCTTAACAGTTTGCTGAGGAGAAT
GAAATTAAAATCTTTACAGCAAACATCATCTATCATTTGTTTGATTAGTTCACCGAATAT
GTAAAGAAATGCAGAGATGAGAGAAAGACTGATGAAGGAACAAAAGCAGTATTTCCCTGT
CTACTTGAAATTGTTAAGGGTGCAATCTTCAACAATAAGAACCCAATCATCATCGGTGTT
ACAGTTAAGGCAGGTATCCTTAAGGTTGGTACTCCACTTTGTATCCCAGAGAAAGGCAAC
TTGAGAATAGGTACCGTAGAATCAATTGAATTGAACAGTAAGCCGGTTCAAACTGCTTAG
AACAAACACGGAAGCGTTGCTGTTAAAATCGGAGGAGAATCACAAGTAATGATAGGAAGA
CACTTTGACGAGAGTAATCAAATTGTTTCCATTCTCACAAGAGACTCAATTGACGCCTTA
AAGCAGTACTTCAAGGACGATCTTAACAAAGATGACTGGAAACTTGTACTCCAACTCAAA
AAGATGTTTGGTATCCCCTGA


>Contig14993.0.g85(protein)
MSSEQEPVDITADVGADGKQALSKAQKKKAKAKAKDVKDVPAEENGAEEEKEEKAGGAKA
KKGKKGAAGGRSAIAALAQQRIKEKEELERIQREEDERIRLEEEAAEKIRLEEENIRKEQ
EERRRKEKRDKIEELKRQGKYLTKAQKQQKEDAERRRNALIAAGMVKPEDPIEDEEPETG
KKHSTLVRNKKKKDKKKDLPTDAQTNINDTTLDTTANTTISSSVGVNGKASVNHEEAKES
VQINTATNDQEEEEDVIDDWENADIDDMTNKIQQKSAKQSSLQGGKAIREDEEEDKLQQE
AQQEKLQKTIQAQAKAKKQVVAEETKGGDMFDRAAESTDKRDKRLAEIRAKREERDQAKM
DRLKRKKEMQQKLRCPIICILGHVDTGKTLILDKLRRTNVQAGEAGGITQQIGATYFPEI
ALREHQQRIKGRIDLELQIPGFQIIDTPGHESFTNLRSRGSNLCDIAILVVDIMHGLEKQ
TLESLQLLLNKKTPFIVALNKIDRIYEWKSEPYRNTRDSIESQAAHCQAEFKERLQKTIL
EFSEQGLNSALYWENPDPTEYISMVPTSAITGEGLPDLMIYISQLCQTMYRENLREKDEF
ECSVLEVKVIEGLGTTIDVILVNGILNVGDTIVLSGFNGPIVSNIRALLTPQPMREMRVK
GDYIHHQSIQGSMGIKISANGLENAIAGSELFRATNEEEIETYKAQIQDDLVDIMDKYVD
KTASGVCVQASTLGSLEALLEFLKTMKIPVTAINIGPVHKKDILKAMKSIAGEFKEREFA
TVLAFDVKITPEAQQFAEENEIKIFTANIIYHLFDQFTEYVKKCRDERKTDEGTKAVFPC
LLEIVKGAIFNNKNPIIIGVTVKAGILKVGTPLCIPEKGNLRIGTVESIELNSKPVQTAQ
NKHGSVAVKIGGESQVMIGRHFDESNQIVSILTRDSIDALKQYFKDDLNKDDWKLVLQLK
KMFGIP