Identifiers and Description

Gene Model Identifier

Contig1970.0.g23

Standard Name

EIF5A2

Aliases

Contig1970_0_g23

Description

Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01287 ) Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
  • ( pfam08207 ) Elongation factor P (EF-P) KOW-like domain
  • ( pfam00467 ) KOW motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002277704.001118334825066e-42translation initiation factor
eIF-5A family p...
SGDYEL034W6.99697739292434e-35HYP2 SGDID:S000000760, Chr V f
rom 85676-86149, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1970.0.g23(coding)
ATGGAAGACTACGAATTCGACACTGGTAACGCTGGAAATGAAGGTATTGAAAAGGTTTCA
GCCGGTTCCCTCAAGAAGGGTGACTTGGTCATGATCAAGGGACACCCCTGCAAGGTCGTT
TCCTTCTCCACTGCCAAGACTGGAAAGCACGGTTCCGCCAAGGCCATGATCACTGGTATT
GATATCTTCACATCCAACAAGTATGAGTGCACTTTCTCCACTGGAGACAACGTTGATGCC
CCACTCATGAAGAGACTTGAATTAACTCTTATCAACATTGAAGAGGATGGATATGTCTCA
CTCATGAACGACGCTGGTGATGTCAAGGAAGATCTTAAGCTCCCCGAGGACGAATGGCTC
AAGGACGTCGCCGACAAGGCCAGAGAAATCTTCAATGATGGAAAGAAGGAGTGCATCGTC
GTAGTCATCTCCTCCATGGACCAAGAGAAGATCATTTCAGTCAAGGAAGGAAAGGACATC
TGA


>Contig1970.0.g23(protein)
MEDYEFDTGNAGNEGIEKVSAGSLKKGDLVMIKGHPCKVVSFSTAKTGKHGSAKAMITGI
DIFTSNKYECTFSTGDNVDAPLMKRLELTLINIEEDGYVSLMNDAGDVKEDLKLPEDEWL
KDVADKAREIFNDGKKECIVVVISSMDQEKIISVKEGKDI